SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000015625 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000015625
Domain Number 1 Region: 291-450
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 2.55e-51
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.0000373
Further Details:      
 
Domain Number 2 Region: 77-186
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.27e-30
Family Spermadhesin, CUB domain 0.00066
Further Details:      
 
Domain Number 3 Region: 191-288
Classification Level Classification E-value
Superfamily LCCL domain 9.29e-24
Family LCCL domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000015625   Gene: ENSDORG00000016609   Transcript: ENSDORT00000016609
Sequence length 781
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_407:42941:92506:-1 gene:ENSDORG00000016609 transcript:ENSDORT00000016609 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASRAVVRAKRGAPCPRVRAAAAAPAWAALPVSGSLPPSSSSSSSSMPPLLLLLLLLLVL
LDDAGAQQGDGCGYTVLGSESGTLSSKNYPQTYPNSSVCEWEIRVKLTERIRIKFGDFDI
EDSDSCHFNYLRIYNGIGMSRTEIGKYCGLALHMNHSIESKSHEITVLFMSGIHVSGRGF
LASYSITNKQDLITCLDTTSNFLEPEFSKYCPAGCLLPFAEISGTIPHGYRDSSPLCMAG
VHAGVISNVLGGQISVVISKGIPYYESSLANNVTSVVGHLSASLFTFKTSGCYGTLGMES
GVIADAQITASSVLEWTDHTGQKNSWKAEKARLRKPGPPWAAFVTDEYQWLQVDLNKEKK
ITGIVTTGSTMAEHKYYVSAYRILYSEDGQKWTMYREPGMEQDKIFQGNKDYHQDVRNNF
LPPITARFIRVNPTQWQQKIAMKMELLGCQVIPKGRSPKTQPPPPRDSNDLTNTTVLPRV
AKGRAPKFIQPLQPRSNKEFPAQTEQTTTTDIKNTTVTPDVTKDVALAAVLVPVLVMVLT
TLILILVCAWHWRNRKKKTEGTYDLPYWDRAVVSLAYDCESWWKGMKQFLPQSVEHEETP
VRXXXXXXXXXXXXXXXXXXXXXXXXYAQPLVGGIVGTLHQRSTFKPEEGKEVGYADLDP
YNSPMTEVYHAYAEPLPITGPEYATPIIMDMSGRPTASVGLPSTSTFKATGNQPPPLVGT
YNVLLSRTDSCSSGRAQYDTPKGGKSGPAAPDEFVYQVPQSAQEVSAAGRDGDCDIFKEI
L
Download sequence
Identical sequences ENSDORP00000015625 ENSDORP00000015625

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]