SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000015632 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000015632
Domain Number 1 Region: 410-467
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.36e-24
Family Classic zinc finger, C2H2 0.0049
Further Details:      
 
Domain Number 2 Region: 97-154
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.19e-23
Family KRAB domain (Kruppel-associated box) 0.001
Further Details:      
 
Domain Number 3 Region: 578-635
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.82e-22
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 4 Region: 522-579
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.33e-22
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 5 Region: 466-523
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.21e-20
Family Classic zinc finger, C2H2 0.0083
Further Details:      
 
Domain Number 6 Region: 354-411
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.69e-20
Family Classic zinc finger, C2H2 0.0093
Further Details:      
 
Domain Number 7 Region: 646-698
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.04e-19
Family Classic zinc finger, C2H2 0.0052
Further Details:      
 
Domain Number 8 Region: 313-364
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000746
Family Classic zinc finger, C2H2 0.0088
Further Details:      
 
Domain Number 9 Region: 689-731
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000348
Family Classic zinc finger, C2H2 0.015
Further Details:      
 
Domain Number 10 Region: 260-302
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000771
Family Classic zinc finger, C2H2 0.025
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000015632
Domain Number - Region: 4-50
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.000106
Family KRAB domain (Kruppel-associated box) 0.0065
Further Details:      
 
Domain Number - Region: 198-243
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00976
Family Classic zinc finger, C2H2 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000015632   Gene: ENSDORG00000016616   Transcript: ENSDORT00000016617
Sequence length 731
Comment pep:novel scaffold:dipOrd1:scaffold_25047:7282:16062:1 gene:ENSDORG00000016616 transcript:ENSDORT00000016617 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VADCTQGSVNFVDVAVNITQEDTVQRNHRSHVMARKPRNLATVGCQKLIKPRAVSLKGEK
SVVQSGAPQELEMQLQTKDLVLQPDFFTGHTCRGTQRGSVTFEDVAVDFTPEEWMSLDPT
QRSLYRDVMLENYRNLATVGGQLFKPSLISWLEEKVELTIVEQGILQEWEMHIKTKGTAV
ERDIVWSDASNRLLAGSHSGGELCDSKQAGKVFGEHSDLQTHTSSANTEHTSECGRCGKA
FLLFKETSAEEKRSLLPLDKFFDCSDCGEAFGDESHLEAHRKTHDGENVCKSEECGQALT
RPTSHDGCGQPPTGKKYYECKKCDKFFTHPIYLNIHMQSHPVEKPYDCKECGKAFPERSG
LIVHLRQHAREKSYECKECGKAFIQPSRLTEHMRSHTGEKPFQCEQCGNAFASSSYLTTH
LRTHTGEKPFECHVCGKAFTRSSYLLGHIRTHTGEKPYECKVCGKAFSGRSWLTIHLRKH
TGERPYPCPECDKAFTSFAQLTEHIKTHTGEKPFRCKVCARTFRNSSCLKTHFRIHTGIK
PYKCTYCGKDFTARSGLTKHVLIHNGEKPYECKECGKAFGTSSGLVEHIRIHTGEKPFEC
YQCGKALAHSSSLVAHLRTHTGEKPFECTLCEKTFTRVLPAHPHTHTGEKPYECKECGKT
FPERSCLTKHIRTHTGERPYECKECGKGFTSFAQLTVHIKTHSNERPFQCKVCTKSFRNS
SRHFRIHTGVK
Download sequence
Identical sequences ENSDORP00000015632 ENSDORP00000015632

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]