SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000015638 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000015638
Domain Number 1 Region: 4-288
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 5.63e-66
Family BAR domain 0.0013
Further Details:      
 
Domain Number 2 Region: 397-513
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 9.55e-32
Family Pyk2-associated protein beta ARF-GAP domain 0.00036
Further Details:      
 
Domain Number 3 Region: 259-363
Classification Level Classification E-value
Superfamily PH domain-like 3.78e-28
Family Pleckstrin-homology domain (PH domain) 0.0036
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000015638
Domain Number - Region: 605-647
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.061
Family Ankyrin repeat 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000015638   Gene: ENSDORG00000016623   Transcript: ENSDORT00000016623
Sequence length 776
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_5483:118109:230346:-1 gene:ENSDORG00000016623 transcript:ENSDORT00000016623 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKITVDFEECLKDSPRFRAALEEVEGDVAELELKLDKXXXXXXXXXXXXXXXCVAKQFMN
GIRDLAQYSSNDAVVETSLTKFSDSLQEMINFHTILFDQTQRSIKAQLQNFVKEDLRKFK
DAKKQFEKVSEEKENALVKNAQVQRNKQHEVEEAANILTATRKCFRHIALDYVLQINVLQ
SKRRSEILKSMLSFMYAHLAFFHQGYDLFSELGPYMKDLGAQXXXXXXXXXXXXXXXXXX
XXXXXXXDFSSDDSKLEYNVDAANGIVMEGYLFKRASNAFKTWNRRWFSIQNNQLVYQKK
FKDNPTVVVEDLRLCTVKHCEDIERRFCFEVVSPTKSCMLQADSEKLRQAWIKAVQTSIA
TAYREKGDESEXXXXXXXXXXXSLDSGNESKEKLKVESALQRVQCIPGNASCCDCGLADP
RWGSINLGITLCIECSGIHRSLGVHFSKVRSLTLDTWEPELLKXXXXXXXXXXXXXXXXX
XGKMGIKKPQPGQRQEKEAYIRAKYVERKFVDKYSLSSSPPELDKKITSKSCEEKRLSIS
KLGPSDQIRASVQSSVKSNDSGIQQSCDDGRESLPSTVSANSLYEPEGERQDSSVFLDSK
HLNPGLQLYRASYEKNLPKMAEALAHGADVNWANSDENKATPLIQAVLGXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXLRLARMNEEMRESEGLYGQPGDETYQDIFRDFSQMASNNPEKLNRFQQDSQKF
Download sequence
Identical sequences ENSDORP00000015638 ENSDORP00000015638

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]