SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000015651 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000015651
Domain Number 1 Region: 324-416
Classification Level Classification E-value
Superfamily BRCT domain 1.24e-16
Family DNA-repair protein XRCC1 0.043
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000015651
Domain Number - Region: 432-494
Classification Level Classification E-value
Superfamily ARM repeat 0.000432
Family GUN4-associated domain 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000015651   Gene: ENSDORG00000016636   Transcript: ENSDORT00000016636
Sequence length 589
Comment pep:novel scaffold:dipOrd1:scaffold_13739:21239:35099:-1 gene:ENSDORG00000016636 transcript:ENSDORT00000016636 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGGLEKKKYERGSATNYITRNKARKKLQLSLADFRRLCILKGIYPHEPKHKKKVNKGSTA
ARTFYLIKDIKFLLHEPIVNKFREYKVFVRKLRKAYGKSEWNTVERLKDNKPNYKLDHIV
KERYPTFIDALRDLDDALSMCFLFSTFPRTGKCHVQTIQLCRRLSVEFLHYVIAARALRK
VFLSIKGIYYQAEVLGQPIVWITPYAFSHDHPTDVDYRVMATFTEFYTTLLGFVNFRLYQ
SLNLHYPPKLEGQVQAETKASEATYALDSESSIEKLAALSASLARVVVPAVEEEAEADEF
PADGEMATQEEERRKELQAQEKHKKLFEGLKFFLNREVPREALAFIIRSFGGEVSWDKSL
CIGATYDVTDSCITHQIVDRPGQQTSVIGRYYVQPQWVFDSVNARLLLPVAEYFPGVQLP
PHLSPFVSEKEGDYIPPEKLKLLALQRGERPEHVKEEEEDEEEEDEEEEEDNEDDGDEGE
ENEEEGTSSEKEEEAQLAAMEEQRLGGKKPRVMAGTVKLEDKQRLAQEEESEAKRLAIMM
MKKREKYLYQKIMFGKRRKIREANKLAEKRKAHDEAMRSEKKAKKARPV
Download sequence
Identical sequences ENSDORP00000015651 ENSDORP00000015651

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]