SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000015657 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000015657
Domain Number 1 Region: 509-565
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000754
Family HkH motif-containing C2H2 finger 0.062
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000015657
Domain Number - Region: 256-297
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000794
Family Classic zinc finger, C2H2 0.088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000015657   Gene: ENSDORG00000016643   Transcript: ENSDORT00000016643
Sequence length 897
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_347:5432:45437:-1 gene:ENSDORG00000016643 transcript:ENSDORT00000016643 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QQPASGVAYSHPTTVASYTVHQAPVAAHTVTAAYAPAAATVAVARPAPVAVAAATAAAYG
GYPTAHTATDYGYTQRQQEAPPPPPPATTQNYQDSYSYVRSTAPAVAYDSKQYYQQPTAT
AAAVAAAAQPQPSVAETYYQTAPKAGYSQGATQYTQAQQTRQVTAIKPATPSPATTTFSI
YPVSSTVQPVAAAATVVPSYTQSATYSTTAVTYSGTSYSGYEAAVYSAASSYYQQQQQQQ
KQAAAAAAAAAATAAWTGTTFTKKTPFQNKQLKPKQPPKPPQIHYCDVCKISCAGPQXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XVVKLHTKLGKPIPSTEPNVVSQATSSTAVSASKPTASPSSIVASNCTVNTSIATSSVKG
LATPGNSSLNSTSNTKISAIPTNMAAKKTSTPKINFVGGNKLQSTGNKTDDLKGAECVKS
TPVASAVQIPEVKPDSVSEPVTPASLAALQSDVQPVGHDYVEEVRNDEGKVIRFHCKLCE
CSFNDPNAKEMHLKGRRHRLQYKKKVNPDLQVEVKPSIRARKIQEEKMRKQMQKEEYWRR
REEEERWRMEMRRYEEDMYWRRMEEEQHHWDDRRRMPDGGYPHGPPGPLGLLGVRPGMPP
QPQGPAPLRRPDSSDDRYVMTKHATIYPTEEELQAVQKIVSITERALKLVSDSLSEHEKS
KSKEGDDKKEGGKDRALKGVLRVGVLAKGLLLRGDRNVNLVLLCSEKPSKTLLSRIAENL
PKQLAVISPEKYDIKCAVSEAAIILNSCVEPKMQVTITLTSPIIREENMREGDVTSGMVK
DPPDVLDRQKCLDALAALRHAKWFQARANGLQSCVIIIRILRDLCQRVPTWSDFPSW
Download sequence
Identical sequences ENSDORP00000015657 ENSDORP00000015657

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]