SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000015678 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000015678
Domain Number 1 Region: 519-861,900-974
Classification Level Classification E-value
Superfamily Ribonuclease H-like 0.000000000000174
Family Hermes transposase-like 0.0074
Further Details:      
 
Domain Number 2 Region: 8-36
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.0000549
Family KRAB domain (Kruppel-associated box) 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000015678   Gene: ENSDORG00000016667   Transcript: ENSDORT00000016667
Sequence length 1069
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_1483:7854:26823:1 gene:ENSDORG00000016667 transcript:ENSDORT00000016667 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPGESGKTPVTFDDITVYLLQEEWMLLSQQPKGLCDSDKLMAPLGKNQMGCMEEMDVRG
PSRESGQSPPPQKEACLASIRAESGIIQGVWRGGSKKPVKPRSIQKSWFAQFPWLIMNEE
QTALFCSACREYPSVRDKRSRLIEGYTGPFKVETLKYHAKSNAHMFCVNALATRDPIWAA
RFQSIRDRSADILTNSKYFFPADYPVFFPSGSLGDLGSMSELLPSSRAEPEETGQCGALP
SLRQDCLSDLRQKEVTIGIHSSSDANLLCNDAVEPCSQPAAAKPDLILKLERRATPWIKD
PNQLKSGKGHPSVKKKAVTVSKADTQVSAAESAPLPALPMETWPSCCPPSMHEVDEGRPQ
KVSRTYRPRSIQRAWFEQFPWLVIDPQETKLFCSVCKERPSVHDKSSRLVQGYTGPFKVE
TLKYHEVSKAHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXRNRTACTQFIRYISETLRKEILSELRSSPCMSVLLDSCTDS
LDQACVGIYIRYFKQMEVKESYITLAPLYSETVDGYFETIIAALDELDIPFRKPGWVVGL
GTDGSTMLSGKGGLVEKFQELIPQLLPVHCVAHRLHLAVVDACGNIDLVRKCDRHLRTIF
KFYQSSNKRLSELRDGAAPLEQEIVRLKDLNAVRWVASKRRTLNALIVSWPTLARHLQSV
ADAGGPVGQRAKGILRLVKGFHFIKFCHFLLDFLSIFRALSEVCQKDMVLITEVNSTLGH
AYVALETLRHRAGPTEEEFNASFQDGQLHGILLARMEMAEQRFQEDRERTVLTGLEYLRH
RFDTDRPPPLKHMEVFDTMAWPGGADLAHFGTDNILSLARYFDLSLPTGYSEEALREEWL
DLKVSAQNLPFSMLCKNTLAQQQRFPLLSKLMAVVICVPISNSCCERGFRAMNRIRTNER
TKLSNEVLNTLMMTAVNGVAVTEYDPQPAIQHWYLTSSGRRFSHVYACTQMPARSQAGTE
LRKEEVVGALCSEKSVTQKMLMTPWGAVGVLKVILAARLPPTSQGSTRS
Download sequence
Identical sequences ENSDORP00000015678 ENSDORP00000015678

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]