SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000015707 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000015707
Domain Number 1 Region: 108-160
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6e-16
Family Classic zinc finger, C2H2 0.0078
Further Details:      
 
Domain Number 2 Region: 85-116
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000641
Family Classic zinc finger, C2H2 0.023
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000015707
Domain Number - Region: 177-216
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000194
Family Classic zinc finger, C2H2 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000015707   Gene: ENSDORG00000016697   Transcript: ENSDORT00000016697
Sequence length 242
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_2468:31094:46090:-1 gene:ENSDORG00000016697 transcript:ENSDORT00000016697 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LGCLLQDPPEDCRSDGGSSSGGGSSSSSSAEPGSAESSSSPRAPECETPEPHHAESPDGP
LAAKQRPVARSKIKFTTGTCGDSVIHSCELCGKNFRLQRMLNRHLKCHNQVKRHLCTFCG
KGFNDTFDLKRHVRTHTGIRPYKCDVCNKAFTQRCSLESHLKKIHGVQQQYAYKQRRDKL
YVCEDCGYTGPTQEDLYLHVNSAHPGSTFLKKTSKKLAALLQSKLTSTHQERITLSEEEE
RK
Download sequence
Identical sequences ENSDORP00000015707 ENSDORP00000015707

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]