SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000015714 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000015714
Domain Number 1 Region: 111-166
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.25e-16
Family Classic zinc finger, C2H2 0.0058
Further Details:      
 
Domain Number 2 Region: 302-352
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000012
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 3 Region: 182-234
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000017
Family Classic zinc finger, C2H2 0.008
Further Details:      
 
Domain Number 4 Region: 75-125
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000766
Family Classic zinc finger, C2H2 0.036
Further Details:      
 
Domain Number 5 Region: 244-271
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000179
Family Classic zinc finger, C2H2 0.0072
Further Details:      
 
Domain Number 6 Region: 277-311
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000329
Family Classic zinc finger, C2H2 0.036
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000015714
Domain Number - Region: 360-385
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00856
Family Classic zinc finger, C2H2 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000015714   Gene: ENSDORG00000016704   Transcript: ENSDORT00000016704
Sequence length 385
Comment pep:novel scaffold:dipOrd1:scaffold_9896:4995:18724:1 gene:ENSDORG00000016704 transcript:ENSDORT00000016704 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LEKGQEQHLLAASTQEQFFLLQVRPGDEGKDEMILTISNLKVEAQPERLTTGLANVEKPT
ARNSQRETVDTKCAFRCSVCPFATSGISSLNRHMKTHTSGKAHVCHLCQKAFRTVTLLRN
HINTHTGTKPYKCVECNAAFVTSGELVRHRRYRHTHEKPFRCSLCQYASVEASKLTRHIR
SHTGERPFQCHLCSYASKDAYKLKRHLRTHSGEKPYECQVCHARFTQSGTMKMHVAQKHS
ENAPKHQCPRCATLIARKSDLRVHLRNLHGYSATELTCRHCPAAFRERYALLQHQRSHRS
EKPFVCQHCGYACQQEWHLAAHRRIHTGEKPFACPACGRCFRQTQLLSVHMKKYQDPSFV
PTVHQCPGCGKGFSRHNMHRHTEQC
Download sequence
Identical sequences ENSDORP00000015714 ENSDORP00000015714

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]