SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000015717 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000015717
Domain Number 1 Region: 491-547
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.9e-21
Family Classic zinc finger, C2H2 0.0062
Further Details:      
 
Domain Number 2 Region: 532-584
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.85e-18
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 3 Region: 435-491
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.24e-16
Family Classic zinc finger, C2H2 0.014
Further Details:      
 
Domain Number 4 Region: 155-197
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.00000000144
Family KRAB domain (Kruppel-associated box) 0.0048
Further Details:      
 
Domain Number 5 Region: 395-436
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000294
Family Classic zinc finger, C2H2 0.017
Further Details:      
 
Domain Number 6 Region: 338-383
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000564
Family Classic zinc finger, C2H2 0.015
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000015717
Domain Number - Region: 50-121
Classification Level Classification E-value
Superfamily Tropomyosin 0.000484
Family Tropomyosin 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000015717   Gene: ENSDORG00000016707   Transcript: ENSDORT00000016707
Sequence length 641
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_6370:219:14740:1 gene:ENSDORG00000016707 transcript:ENSDORT00000016707 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEAAAAPTSEWDTECLTSLQPLSLPTPPAANEAHLQTAAISLWTVVAAVQAIERKVEVH
SRRLLHLEGRTGTAEKKLASCEKTVSELGNQLEGKWAVLGTLLQEYGLLQRRLENLENLL
RNRNFWILRLPPGVKGDIPKXXXXXXXXXXXXXXPEWEKLEEWQKELYKNIMKGNYESLI
SMDYAMNQPDVLSQIQPEGEHNPENQAGPEESAIPTDPSEEPGLSTSDILSWIKQEEEPQ
VGAPQEAKESDMYKGSYPEELVVKAEGLARTLCSEVPPTFPASAAPAAKDAFSEAPFKGQ
QPAPGTHFGCPATDLPEASEGQVTFTQLGSYPLPPPLGEQVFSCHHCGKSLSQDLLLTHQ
CGHAGEHLLPCAQCPKHFPTQADLGSTSQDQAGAPPPTCPHCARTFTHPSRLTYHLRVHN
STERPFLCPDCPKRFADQARLTSHRRAHASERPFRCTQCGRSFSLKISLLLHQRGHAQER
PFSCPQCGIDFNGHSALIRHQMIHTGERPYPCTDCSKSFMRKEHLLNHRRLHTGERPFQC
AHCGKSFIRKHHLMKHQRIHTGERPYPCALCGRSFRYKQTLKDHLRSGHSGGCAGDGDPT
TQPPDPSGPLLTVLETSGVGVNTEGLETNQWYGEGSGGGVL
Download sequence
Identical sequences ENSDORP00000015717 ENSDORP00000015717

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]