SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000015718 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000015718
Domain Number 1 Region: 194-253
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 8.24e-16
Family KRAB domain (Kruppel-associated box) 0.0026
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000015718
Domain Number - Region: 92-173
Classification Level Classification E-value
Superfamily Tropomyosin 0.0124
Family Tropomyosin 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000015718   Gene: ENSDORG00000016708   Transcript: ENSDORT00000016708
Sequence length 486
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_6370:23050:37844:1 gene:ENSDORG00000016708 transcript:ENSDORT00000016708 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQFVSTRPQPQQLGIHGLGLDGGSWSWAQALPPDEVCHQEPALRGEMAEGMPPMQAQEWD
MDARRPMPFQFPPFPDRAPVFPDRMMREPQLPTAEISLWTVVAAIQAVERKVDAQASQLL
NLEGRTGTAEKKLADCEKTAVEFGNHMESKWAVLGTLLQEYGLLQRRLENLENLLRNRNF
WVLRLPPGTKGEAPKVPVTFVDIAVYFSEDEWKNLDEWQKELYNNLVKENYKTLMSLDAE
GPVSKPDAPAQVEPREEPCVWEQRHPEEREVPVDADTGAEPLVPAQDLPSQVKREEALCV
RSQRNLEERAIPTESITDSPISAQDLLSRIKQEEQQCVWDQQDLAERDIPTDPNSESLIS
AHDILSWIKQEEQPYPWGPRDSMEGELGLDSGPSDSLLMVKNAAPAPPQPHQQSLPPLPV
PEHPGGPGSRGLLDNGGFPALPGERGGGEALAGGESGGGGGGCAGASGGGLGGATGPGAE
GCGSCC
Download sequence
Identical sequences ENSDORP00000015718 ENSDORP00000015718

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]