SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000015862 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000015862
Domain Number 1 Region: 170-227
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.6e-24
Family Classic zinc finger, C2H2 0.0036
Further Details:      
 
Domain Number 2 Region: 338-395
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.21e-23
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 3 Region: 394-451
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.41e-23
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 4 Region: 282-339
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.13e-20
Family Classic zinc finger, C2H2 0.0096
Further Details:      
 
Domain Number 5 Region: 212-264
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.89e-20
Family Classic zinc finger, C2H2 0.0056
Further Details:      
 
Domain Number 6 Region: 133-184
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000411
Family Classic zinc finger, C2H2 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000015862   Gene: ENSDORG00000019727   Transcript: ENSDORT00000019789
Sequence length 477
Comment pep:novel scaffold:dipOrd1:scaffold_39175:2849:9684:-1 gene:ENSDORG00000019727 transcript:ENSDORT00000019789 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TKPDRILKLEVEELSPADGKIWNFPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXKPYVYKECEKGFKCKKGLLHQRFKNGEKPFECTACQKTFSKKSHLTVH
WKTHTGEKPFGCTECGKAFIQKSQLIIHLRTHTGERPFECPECGKAFPEKSTVIIHYRTH
TGEKPFECSEWGKAFTQKSNLIVHQKTHTGKKKCEFTKCGESFMQKLDLIIHHSTHMGKK
PHECSDYKKTFSDKSTLVVHQRTHSGEKPYECNECEKAFSQKSYLMLHQRGHTGEKLYDC
SECEKAFTQKSYLIIHQRTHSGKKPYKCNECDKAFREKSKLIIHQRIHTREKPYECPMCW
KAFCQKSQLIVHQRTLTGEKPYKCTICGKAFKEERPTRHGVYILKVHSRTWECAWSA
Download sequence
Identical sequences ENSDORP00000015862 ENSDORP00000015862

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]