SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000000080 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000000080
Domain Number 1 Region: 90-416
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 3.89e-44
Family FAD/NAD-linked reductases, N-terminal and central domains 0.000000754
Further Details:      
 
Domain Number 2 Region: 445-573
Classification Level Classification E-value
Superfamily FAD/NAD-linked reductases, dimerisation (C-terminal) domain 1.65e-30
Family FAD/NAD-linked reductases, dimerisation (C-terminal) domain 0.00000114
Further Details:      
 
Domain Number 3 Region: 1-85
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.35e-23
Family Thioltransferase 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000000080   Gene: ENSDORG00000000091   Transcript: ENSDORT00000000091
Sequence length 575
Comment pep:novel scaffold:dipOrd1:scaffold_22091:77:20715:-1 gene:ENSDORG00000000091 transcript:ENSDORT00000000091 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
NVIIFINNYCPPSQRVKELFASLGVDYNILELDQVDDGANVQEMLLEITNQKTVPNIFVN
KVHVGGCDRIFQAHQNGLLQKLLQEDSVHDYDLIIIGGGSGGLSCAKEAAILGKKVMVLD
FVVPSPQGASWGLGGTCVNVGCIPKKLMHQAALLGQALNDSRKFGWEYSQQVKHNWETMT
QAIQSHIGSLNWGYRLSLREKGVTYVNSYGEFVEPHKIKATNKKGQETYHTASKFVIATG
ERPRYLGIPGDKEYCITSDDLFSLSYCPGKTLVVGASYVALECAGFLAGFGLDVTVMVRS
ILLRGFDQEMAEKVGAYMEKHGVKFIRKFVPVAIQQLEKGSPGKLKVLAKSTEGPETIEG
VYNTVLLAIGRDSCTKKVGLEKIGVRINEKSGKIPVNDVEQTTVPYVYAVGDVLEGRPQL
TPVAIQAGKLLARRLFGTSLEKCDYTNVLTTVFTPLEYGCCGLSEERAIEVYKKENMEVY
HTLFWPLEWTVAGRENSACYAKIICNKCDHDRIVGLHVLGPNAGEITQGFAAAMKCGLTK
QLLSDTIGIHPTCGEVFTTLEITKSSGLDITQKGC
Download sequence
Identical sequences ENSDORP00000000080 ENSDORP00000000080

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]