SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000000265 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000000265
Domain Number 1 Region: 639-695
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.12e-23
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 2 Region: 583-639
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.27e-23
Family Classic zinc finger, C2H2 0.0072
Further Details:      
 
Domain Number 3 Region: 680-732
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.86e-17
Family Classic zinc finger, C2H2 0.0059
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000000265
Domain Number - Region: 535-583
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00643
Family Classic zinc finger, C2H2 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000000265   Gene: ENSDORG00000000287   Transcript: ENSDORT00000000286
Sequence length 764
Comment pep:novel scaffold:dipOrd1:scaffold_26653:1301:12626:1 gene:ENSDORG00000000287 transcript:ENSDORT00000000286 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QSSPWVPVSANEWGTVDEEVTTSHLPARSQEPPRDTHTRGFSYRKRVNPIPAHTGFCRDD
RKESAGNRVSLVSASNKTARLEQRKEPWTVGLHSLNKRSILQSSYVKEKAVHAVQIPARS
AGKAWKEPQQWGLEDEKIAGVHWSYEETKTFLAILKESRFYETLQACPRNSQVYGAVAEW
LRECGFLRTPEQCRTKFKSLQKSYRKVRNGHVLEPCAFFEDMDALLNPAAHAPSADKPKQ
VISLPRLKRIAVCAREQVSLVEEEAAEESDGDEMGVEFIRKSEVRGAPVLFQNLSXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEPQESTGWEA
EESSQETVIEDSGSDQMSEEETVQEPEFRGPPSLLQSPPDFEIISTVKEDLAHVTYKDTD
PHRVFLEKSRRAVSQNADPSKFQKRECISGRQWANLQAMRQGKLMAQPRDLGRAVVHPRP
FVGKRPSRLLKYGESFGKNARLVCRMTHPKENPYKCGVCGKGFGRSRSLMRHQRIHTGEK
PFKCLDCGKSFNDSSNFGAHQRVHTGEKPYRCGECGKCFSQSSSLVIHQRTHTGEKPYQC
GECGKSFTNSSHFSAHRRVHTGENPYKCGDCEKSFNNCTRFREHLRIHTGEKPYGCGQCG
KRFSKSSVLTKHREVHGRQLLTHPASLYTPETLPKGKSEEFRKT
Download sequence
Identical sequences ENSDORP00000000265 ENSDORP00000000265

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]