SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000000332 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000000332
Domain Number 1 Region: 511-760
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.75e-67
Family Protein kinases, catalytic subunit 0.0000658
Further Details:      
 
Domain Number 2 Region: 333-445
Classification Level Classification E-value
Superfamily PH domain-like 3.48e-30
Family Pleckstrin-homology domain (PH domain) 0.0000176
Further Details:      
 
Domain Number 3 Region: 36-107
Classification Level Classification E-value
Superfamily Cysteine-rich domain 2.09e-20
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.00071
Further Details:      
 
Domain Number 4 Region: 172-231
Classification Level Classification E-value
Superfamily Cysteine-rich domain 3.29e-19
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000000332   Gene: ENSDORG00000000354   Transcript: ENSDORT00000000355
Sequence length 818
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_5978:3295:164934:-1 gene:ENSDORG00000000354 transcript:ENSDORT00000000355 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FPECGFYGMYDKIVLFRHDPTSENIQLVKTASDIQEGLIEVVLSASATFEDFQIRPHALF
VHSYRAPAFCDHCGEMLWGLVRQGLKCEGCGLNYHKRCAFKIPNNCSGVRRRRLSNVSLT
GLSTTRTSSTELSTSAPDEPLLQKSPSESFIGREKRSNSQSYIGRPIQLDKMLMSKVKVP
HTFVIHSYTRPTVCQYCKKLLKGLFRQGLQCKDCRFNCHKRCAPKVPNNCLGEVTINGDL
LSPGAESDVVMEEGSDDNDSERNSGLLDDMEEAMVQDTEMAMAEGQSDSGEMQDADPDQE
DSNRTISPSTSNNIPLMRVVQSVKHTKRKSSTVMKEGWMVHYTSKDTLRKRHYWRLDSKC
ITLFQNDTGSRYYKEIPLSEILSLEPAKSAALILSGANPHCFEITTANVVYYVGENVVNP
SSPPPNNSIFTSGIGADVAKMWETAXXXXXXXXXXXXXXXXXXXXXXXDISVSISVSNSQ
IQENVXXXXXXXXXXXXXXXXXXXXXXXXXKHRKTGRDVAIKIIDKLRFPTKQESQLRNE
VAILQNLHHPGVVNLECMFETPERVFVVMEKLHGDMLEMILSSEKGRLPEHITKFLITQI
VALRHHNIVHCDLKPENVLLASADPFPQAKLCDFGFARIIGEKSFRRSVVGTPAYLAPEV
LRNKGYNRSLDMWSVGVIIYVSLSGTFPFNEDEDIHDQIQNAAFMYPPNPWKEISHEAID
LINNLLQVKMRKRYSVDKTLSHPWLQDYQTWLDLRELECKMGERYITHESDDSRWQQYAG
EQGLQYPPHLIDPSASHSDSPETEEGEMKALSQRVSIL
Download sequence
Identical sequences ENSDORP00000000332 ENSDORP00000000332

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]