SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000000539 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000000539
Domain Number 1 Region: 420-469
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.29e-18
Family Classic zinc finger, C2H2 0.0026
Further Details:      
 
Domain Number 2 Region: 133-179
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.000000000000549
Family KRAB domain (Kruppel-associated box) 0.0036
Further Details:      
 
Domain Number 3 Region: 357-400
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000531
Family Classic zinc finger, C2H2 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000000539   Gene: ENSDORG00000000581   Transcript: ENSDORT00000000579
Sequence length 487
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_5232:705:14999:1 gene:ENSDORG00000000581 transcript:ENSDORT00000000579 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAESAPARHRRKRRSTPLATSMTSSQTGEKSPYFQTAEISLWTVVAALHAVEKKMESQAA
RLQNLEGRTGTAEKLADCEKTAEFGNQLEGKWAVLGTLLQEYVLRRLENVENLLRNRNFW
VLRLPPGSKGEAPKVSKSLENDGVCFSEQEWENLEEWQKELYRNVMQSNYETLVSLKVLG
QPEEEAELGTEMLGDLEEEGPHGTHLVDGAMGKQEGLAGLPSRFVGTAEEQAFLGSEQAE
LWDGQDGSILLESGPGVSNLEEPTEDNRDPASARTLDCPQKQKSRRQVLLGQEYEPGXXX
XXXXXXXXXXXXXXXXXXXXXQLVTHLQSHSGWEPRPATEPEEIHRPRPRLKPQARKTKL
HQCDVCQRSFSCKLSLMTHQRCHLQEGPSASPRVQERFSPNSLVALPGHIPWRKSRSSLI
CGYCGKSFSHPSDLVRHQRIHTGERPYSCSECEKSFVQKQHLLQHQKIHQRERGGPAPEP
GRPNGLL
Download sequence
Identical sequences ENSDORP00000000539 ENSDORP00000000539

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]