SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000000551 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000000551
Domain Number 1 Region: 498-664,720-873
Classification Level Classification E-value
Superfamily L domain-like 6.08e-45
Family Ngr ectodomain-like 0.00017
Further Details:      
 
Domain Number 2 Region: 1142-1331
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.74e-41
Family Laminin G-like module 0.0016
Further Details:      
 
Domain Number 3 Region: 271-476
Classification Level Classification E-value
Superfamily L domain-like 5.1e-29
Family Ngr ectodomain-like 0.00031
Further Details:      
 
Domain Number 4 Region: 28-201
Classification Level Classification E-value
Superfamily L domain-like 0.000000000000015
Family Ngr ectodomain-like 0.0016
Further Details:      
 
Domain Number 5 Region: 983-1111
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000298
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number 6 Region: 913-954
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000336
Family EGF-type module 0.0046
Further Details:      
 
Domain Number 7 Region: 956-995
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000193
Family EGF-type module 0.01
Further Details:      
 
Domain Number 8 Region: 1327-1368
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000803
Family EGF-type module 0.013
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000000551
Domain Number - Region: 1417-1446
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000126
Family EGF-type module 0.014
Further Details:      
 
Domain Number - Region: 1370-1407
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000516
Family EGF-type module 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000000551   Gene: ENSDORG00000000584   Transcript: ENSDORT00000000592
Sequence length 1527
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_3653:92154:297589:1 gene:ENSDORG00000000584 transcript:ENSDORT00000000592 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPGVGWQMLSLTLGLVLAIVNPAAPQACPAQCSCSGSTVDCHGLALRSVPRNIPRNTERL
XXXXXXXXXXXXXXXXXXXXXXXXQLMENKISTIERGAFQDLELERLRLNRNHLQLFPEL
LFLGTSKLYRLDLSENQIQAIPRKAFRGAVDIKNXXXXXXXXXXXXXXXXXXXXXXXXXT
LNNNNITRLSVASFNHMPKLRTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXHQSFMAPSCSVLHCPAACTCSNNIVDCRGKGLTEIPTNLPET
ITEIRLEQNSIKVIPPGAFSPYKKLRRILSNNQISELAXXXXXXXXXXXXXVLYGNKITE
LPKSLFEGLFSLQLLLLNANKINCLRVDAFQDLHNLNLLSLYDNKLQTIAKGTFSALRAI
QTMHLAQNPFICDCHLKWLADYLHTNPIETSGARCTSPRRLANKRIGQIKSKKFRCSAKE
QYFIPGTEDYRSKLSGDCFADLACPEKCRCEGTTVDCSNQKLNKIPDHIPQYTAELRLNN
NEFTVLEATGIFKKLPQLRKINFSNNKITDIEEGAFEGASGVNEILFTSNRLENVRYKMF
KGLESLKTLMLRSNRISCVGNDSFIGLSSVRLLSLYDNQITTIAPGAFDTLHSLSTLNLL
ANPFNCNCYLAWLGEWLRKKRIVTGNPRCQKPYFLKEIPIQDVAIQDFTCDDGNDDNSCS
PLSRCPVECTCLDTVVRCSNKGLKILPKGIPRDVTELYLDGNQFTLVPKELSNYKHLTLI
DLSNNRISTLSNQSFSNMTQLLTLILSYNRLRCIPSRTFDGLKSLRLLSLHGNDISVVPE
GAFNDLSALSHLAIGANPLYCDCNMQWLSDWVKSEYKEPGIARCAGPGEMADKLLLTTPS
KKFTCQGPVDVNILAKCNPCLSNPCKNDGTCNNDPVDFYRCTCPYGFKGQDCDVPIHACI
SNPCKHGGTCHLKEGEKEGFWCICADGFEGENCEINVDDCEDNDCENNSTCVDGINNYTC
LCPPEYTGELCEEKLDFCAQDLNPCQHDSKCILTPKGYKCDCTPGYIGEHCDIDFDDCQD
NKCTNGAHCTDAVNGYTCICPEGYSGLFCEFSPPMVLPRTSPCDNFDCQNGAQCIIRINE
PICQCLPGYQGEKCEKLVSVNFVNKESYLQIPSAKVQPQTNITFQIATDEDSGILLYKGD
KDHIAVELYRGRVRASYDTGSHPASAIYSVETINDGNFHIVELLALDQSLSLSVDGGSPK
IITNLSKQSTLNLDSPLYVGGMPGKNNVASLRQAPGQNGTSFHGCIRNLYINSELQDFQK
VPMQTGILPGCEPCHKKVCAHGTCQPGSPTGFTCECEEGWMGPLCDQRTNDPCLGNKCVH
GTCLPINAFSYSCKCLEGHGGVLCDEEEDLFNPCQTIKCKHGKCRLSGLGQPYCECSSGY
TGDSCDREISCRGERIRDYYQKQQGYAACQTTKKVSRLECKGGCVGGQCCGPLRSKRRKY
SFECTDGSSFVDEVEKVVKCGCMRCIS
Download sequence
Identical sequences ENSDORP00000000551 ENSDORP00000000551

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]