SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000000698 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000000698
Domain Number 1 Region: 230-496
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 9.7e-68
Family Protein kinases, catalytic subunit 0.00000000872
Further Details:      
 
Domain Number 2 Region: 120-263
Classification Level Classification E-value
Superfamily SH2 domain 1.05e-37
Family SH2 domain 0.00000877
Further Details:      
 
Domain Number 3 Region: 60-145
Classification Level Classification E-value
Superfamily SH3-domain 6.68e-22
Family SH3-domain 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000000698   Gene: ENSDORG00000000747   Transcript: ENSDORT00000000747
Sequence length 508
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_3796:5458:126629:1 gene:ENSDORG00000000747 transcript:ENSDORT00000000747 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PWSSATTAPKLSRRAGNMGCIKSKRKDNLNDDGVDLKTQPVSDSQLLPGQRFQTKDPEEQ
GDIVVALYPYDGIHPDDLSFKKGEKMKVLEEHGEWWKAKSLSTKREGFIPSNYVAKVNTL
ETEEWFFKDITRKDAERQLLAPGNSAGAFLIRESETLKGSFSLSVRDYDPVHGDVIKHYK
IRSLDNGGYYISPRITFPCISDMIKHYQKQPDGLCRRLEKACISPKPQKPWDKDAWEIPR
ESIKLVKKLGAGQFGEVWMGYYNNSTKVAVKTLKPGTMSVQAFLEEANLMKSLQHDKLVR
LYAVVTREEPIYIITEYMAKXXXXXXXXXXXXXXXXXXXXXXXXXXIAEGMAYIERKNYI
HRDLRAANVLVSESLMCKIADFGLARVIEDNEYTAREGAKFPIKWTAPEAINFGCFTIKS
DVWSFGILLYEIVTYGXXXXXXRTNADVMTALSQGYRMPRMENCPDELYEIMKMCWKEKA
EERPTFDYLQSVLDDFYTATEGQYQQQP
Download sequence
Identical sequences ENSDORP00000000698 ENSDORP00000000698

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]