SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000000904 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000000904
Domain Number 1 Region: 210-267
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.69e-27
Family Classic zinc finger, C2H2 0.0056
Further Details:      
 
Domain Number 2 Region: 127-180
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.2e-23
Family Classic zinc finger, C2H2 0.0078
Further Details:      
 
Domain Number 3 Region: 252-304
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.56e-21
Family Classic zinc finger, C2H2 0.0052
Further Details:      
 
Domain Number 4 Region: 1-45
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 4.97e-18
Family KRAB domain (Kruppel-associated box) 0.0013
Further Details:      
 
Domain Number 5 Region: 321-365
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000628
Family Classic zinc finger, C2H2 0.015
Further Details:      
 
Domain Number 6 Region: 89-125
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000283
Family Classic zinc finger, C2H2 0.016
Further Details:      
 
Domain Number 7 Region: 170-205
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000179
Family Classic zinc finger, C2H2 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000000904   Gene: ENSDORG00000000963   Transcript: ENSDORT00000000963
Sequence length 365
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_6776:65047:77554:-1 gene:ENSDORG00000000963 transcript:ENSDORT00000000963 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QKLMSFADVAVNFTWKEWQDLDPGQRNLYREVMLETYSNLISLXXXXXXXXXXXXXXXXX
XXXXXXXXXXGGKRSLAVRAWVFSVNLVRCVCNICGKSYICKAYLTRHQRTGEKPYECNM
FGKSFTKSKLTVHQRTHTGEKPYECNVCGKSFIQKSKLTVHQRTHTKKKPFECNICGKSF
ICKAYKTHLTVHQRTHTKEKPFECNICGKSFTQKSNLTLHQRTHTGEKPYECNICGKSFS
WKAYLTLHQRTHTGEKPYECNKCGKSFTQKSILTRHQRTHTREKPYECNMCRKSFTWKSN
LNVHQNHTGKKPYECHKCKIFHPEADLTVHQRAHTGENFYECKMCGKSFTKKSNLNLHQR
THNRE
Download sequence
Identical sequences ENSDORP00000000904 ENSDORP00000000904

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]