SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000001059 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000001059
Domain Number 1 Region: 236-278
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000168
Family EGF-type module 0.01
Further Details:      
 
Domain Number 2 Region: 313-351
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000003
Family EGF-type module 0.014
Further Details:      
 
Domain Number 3 Region: 197-240
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000604
Family EGF-type module 0.0094
Further Details:      
 
Domain Number 4 Region: 158-193
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000143
Family EGF-type module 0.0086
Further Details:      
 
Domain Number 5 Region: 270-311
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000114
Family EGF-type module 0.019
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000001059
Domain Number - Region: 109-133
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0113
Family EGF-type module 0.066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000001059   Gene: ENSDORG00000001125   Transcript: ENSDORT00000001125
Sequence length 506
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_919:1023:10304:1 gene:ENSDORG00000001125 transcript:ENSDORT00000001125 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GTFSLXXXXXXXXXXXXXXXTTWSNLTRVTGRQRLAAGVPWTRDAQRASAWELRFSYRAR
CEPPAAGLACTRLCRSRGAPSRCGPGLRPCAPFEDHQDPPPCRAGCSPEHGFCEQPDECQ
CQEGWTGPLCTIPVAISSCLSPGSLPSAISECLGPGPGPCDGNPCANGGSCSETPGSFEC
ACPRGFYGPRCEVSGVTCADGPCFNGGLCVGGADPDSAYVCHCPPGFQGSNCEKRVDRCS
LQPCQNGGLCLDLGHALRCRCRAGFAGPRCEHDLADCASRACANGGTCVEGGGGARRCSC
ALGFGGRDCRERADPCAARPCAHGGRCYAHFSGLVCACAPGYMGTRCEFPVRPDGADQGA
GAVPAIPPGPRRADPQRFLLPPALGLLVAAGLGGAALFVVQVRRRGSGRDAGSRLLAGTP
EPAGHMLPDALNNRRTQEGPGDGPSSSIDWNRPEDGDSQSIYIISAPCVYAREVAAPLIP
PVHVGVSGQRQPLLFFFPALIFTRKL
Download sequence
Identical sequences ENSDORP00000001059 ENSDORP00000001059

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]