SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000001076 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000001076
Domain Number 1 Region: 83-172
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 2.24e-26
Family Nuclear receptor 0.00013
Further Details:      
 
Domain Number 2 Region: 213-304
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 6.16e-20
Family Nuclear receptor ligand-binding domain 0.00000314
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000001076   Gene: ENSDORG00000001148   Transcript: ENSDORT00000001147
Sequence length 304
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_2713:25312:27760:1 gene:ENSDORG00000001148 transcript:ENSDORT00000001147 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSPTTSSRDKPLPGNGPPQPSTSSSSPAIKQEGPEPWPEGPVPDVPGTDGAGSACTGXX
XEAEEEPERKRKKGPAPKMLGHELCRVCGDKASGFHYNVLSCEGCKGFFRRSVVHGGAGR
YACRGSGTCQMDAFMRRKCQLCRLRKCKEAGMREQCVLSEEQIRKKKIQKQQQQQQLPPV
EPSGSSCPTSGPGASPGGSEAGSQGSGEGEGVQLTAAQELMIQQLVAAQLQCNKRSFSDQ
PKVTPWPLGADPQSRDARQQRFAHFTELAIISVQEIVDFAKQVPGFLQLGREDQIALLKA
STIE
Download sequence
Identical sequences ENSDORP00000001076 ENSDORP00000001076

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]