SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000001664 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000001664
Domain Number 1 Region: 46-281
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 3.63e-81
Family Eukaryotic proteases 0.00000188
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000001664   Gene: ENSDORG00000001774   Transcript: ENSDORT00000001777
Sequence length 282
Comment pep:novel scaffold:dipOrd1:scaffold_15170:7354:12251:1 gene:ENSDORG00000001774 transcript:ENSDORT00000001777 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRKLRCLKDWQASSRVHPASKAPGACPAPLQAAMILQFLTLALVTGHVGGETRIIKGYEC
KPHSQPWQVALFQKTRLLCGATLIAPRWLLTAAHCRKPRYLVLLGEHNLQRQDGCEQRRM
ATESFPHPGFNNSLPNKDHRNDIMLVKMTSPAVITHSVRPLTLSPHCVAAGTDCLISGWG
TTSSPQLHLPHSLRCANISIIGHKECESAYPGNITDTMLCASVRKGGKDSCQGDSGGPLV
CDGSLQGIISWGQDPCAVTRKPGVYTKVCKYVDWIHKTMKNN
Download sequence
Identical sequences ENSDORP00000001664 ENSDORP00000001664

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]