SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000001802 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000001802
Domain Number 1 Region: 313-370
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.89e-25
Family Classic zinc finger, C2H2 0.0033
Further Details:      
 
Domain Number 2 Region: 369-426
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.48e-25
Family Classic zinc finger, C2H2 0.0044
Further Details:      
 
Domain Number 3 Region: 201-258
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.13e-23
Family Classic zinc finger, C2H2 0.0039
Further Details:      
 
Domain Number 4 Region: 257-314
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.56e-23
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 5 Region: 411-463
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.05e-19
Family Classic zinc finger, C2H2 0.0045
Further Details:      
 
Domain Number 6 Region: 163-215
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.48e-18
Family Classic zinc finger, C2H2 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000001802   Gene: ENSDORG00000001921   Transcript: ENSDORT00000001921
Sequence length 483
Comment pep:novel scaffold:dipOrd1:scaffold_36104:5127:11111:-1 gene:ENSDORG00000001921 transcript:ENSDORT00000001921 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LCLCKPSMISMLEQGKEPWMVANKLTNDVCSDWESMGETEESAPKQELCQAQPCQKITGK
LADIGLDYSSLKEEGKCEGNLEGQPGNEKTSCEKETVTYEEALLNKQEQDFNKSLGSFHQ
NILLPIQQTIPKQEKVYNQDTWQNTIQNTSPTVQPQGVYAKKKVLKCNYCDKVFTQSSPF
TLHQRVHTGEKPYKCAECGKAFSHRSNLVQHHRIHTGERPYECKECNKAFSQNAHLLQHL
RVHTGEKPYECKVCRKAFGQFAYLAQHQRVHTGEKPYECIVCGKAFSNRSSIAQHHRAHT
GEKPYKCNVCGKAFSLRAYLTEHQRIHTGERPYECKECGKAFSQNSHLAQHQRIHTGEKP
YKCQQCKKAFSQITYLAQHQRVHTGEKPYECIKCGKAFSNDSSLTRHERVHTGEKPYECN
VCGKAFSYCGSLTQHQRIHTGERPYECKECKKSFRQHAHLAQHQRIHTGGFLSSSNPVSH
HVI
Download sequence
Identical sequences ENSDORP00000001802 ENSDORP00000001802

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]