SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000002343 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000002343
Domain Number 1 Region: 3-47
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000227
Family EGF-type module 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000002343   Gene: ENSDORG00000002497   Transcript: ENSDORT00000002495
Sequence length 106
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_5203:4202:30649:-1 gene:ENSDORG00000002497 transcript:ENSDORT00000002495 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
HEEPCGPGHRSFCLNGGICYVIPTIASPFCRCVENYTGARCEEVFLPSLSVQSKSNVPAG
VVALAVLVTVAFAALYFLCRRGHLPRSRWSPCEVSLVEADSASAGH
Download sequence
Identical sequences ENSDORP00000002343 ENSDORP00000002343

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]