SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000002516 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000002516
Domain Number 1 Region: 28-224,455-522
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.3e-58
Family Ankyrin repeat 0.0000838
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000002516   Gene: ENSDORG00000002680   Transcript: ENSDORT00000002678
Sequence length 605
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_2583:32122:42880:1 gene:ENSDORG00000002680 transcript:ENSDORT00000002678 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ALLLNRSESDIRYLLGYVSQQGGQRSTPLIIAARNGHAKVVRLLLEHYRVQTQQTGTVRF
DGYVIDGATALWCAAGAGHFEVVKLLVSHGANVNHTTVTNSTPLRAACFDGRLDIVKYLV
ENNANISIANKYDNTCLMIAAYKGHTDVVRYLLEQRADPNAKAHCGATALHFAAEAGHLD
IVKELIKWRAAIVVNGHGMTPLKVAAESCKADVVELLLSHADCDRRSRIEALELLGASFA
NDRENYDIMKTYHYLYLAMLERFQDGENILEKEVLPPIHAYGNRTECRNPQLESIRXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLHLRQKGNRNTH
KDLLRFAQVFSQMIHLNETVKAPDIECVLRCSVLEIEQSMNRVKNITDADVHSAMDNYEC
NLYTFLYLVCISTKTQCSEEDQCKINKQIYNLIHLDPRTREGFTLLHLAVNSNTPVDDFH
TNDVCSFPNALVTKLLLDCGAEVNAVDNEGNSALHIIVQYNRPISDFLTLHSIIISLVEA
GAHTDMTNKQNKTPLDKSTTGVSEILLKTQMKMSLKCLAARAVRANDINYQDQIPRTLEE
FVGFH
Download sequence
Identical sequences ENSDORP00000002516 ENSDORP00000002516

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]