SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000002925 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000002925
Domain Number 1 Region: 21-148
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.26e-20
Family Pentraxin (pentaxin) 0.00000231
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000002925   Gene: ENSDORG00000003120   Transcript: ENSDORT00000003120
Sequence length 151
Comment pep:novel scaffold:dipOrd1:scaffold_1790:4:633:-1 gene:ENSDORG00000003120 transcript:ENSDORT00000003120 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEKLLLCFLVSISFSDAFGQTDLSKKAFVFPKETDNSYVSLEGQLTKPLKAFTVCLQMYT
ELSKTRGFSIFSYATKKQPNEILIFWSKNRGYAFGVGGPEVLFKAAEIPEAPVHICASWE
SVTGIAEFWVDGRPRVRMSLNKGYTVQPEAS
Download sequence
Identical sequences ENSDORP00000002925 ENSDORP00000002925

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]