SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000003022 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000003022
Domain Number 1 Region: 13-43
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000476
Family CHHC finger 0.019
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000003022
Domain Number - Region: 47-74
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000309
Family CHHC finger 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000003022   Gene: ENSDORG00000003228   Transcript: ENSDORT00000003229
Sequence length 167
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_5269:930:13521:-1 gene:ENSDORG00000003228 transcript:ENSDORT00000003229 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEDTYIDSLDPEKLLQCPYDKNHQIRACRFPYHLIKCRKNHRDVANKLATCPFNARHQVP
RAEISHHISSCDDKSCIEQDVVNQTRNLKQETLAESTWQCPPCDEDWDKDLWEQTSTPFV
WGTANFCGNNSPASNIVMEHKSNLASGMRVPKSLPYVLPWKNNGNAQ
Download sequence
Identical sequences ENSDORP00000003022 ENSDORP00000003022

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]