SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000003574 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000003574
Domain Number 1 Region: 20-144
Classification Level Classification E-value
Superfamily Lysozyme-like 3.75e-32
Family C-type lysozyme 0.0000627
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000003574   Gene: ENSDORG00000003826   Transcript: ENSDORT00000003826
Sequence length 146
Comment pep:novel scaffold:dipOrd1:scaffold_25282:2388:5981:-1 gene:ENSDORG00000003826 transcript:ENSDORT00000003826 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKTALLISLASCLLVLNDRIGRCELAKILRKEHLDGFEGYTLNEXXXXXXXXXXXXXXXX
XXNADGSYDYGIFQINSHYWCNDYKSHSENFCHMDCKDILEPNLISAMQCAKKIVSGSSG
MKNWVQWILHCSGRPLSHWMTGCKVQ
Download sequence
Identical sequences ENSDORP00000003574 ENSDORP00000003574

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]