SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000003719 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000003719
Domain Number 1 Region: 81-360
Classification Level Classification E-value
Superfamily L domain-like 1.87e-52
Family Ngr ectodomain-like 0.0015
Further Details:      
 
Domain Number 2 Region: 417-497
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000156
Family Fibronectin type III 0.0027
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000003719
Domain Number - Region: 34-78
Classification Level Classification E-value
Superfamily L domain-like 0.000136
Family Ngr ectodomain-like 0.0086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000003719   Gene: ENSDORG00000003985   Transcript: ENSDORT00000003985
Sequence length 660
Comment pep:novel scaffold:dipOrd1:scaffold_1675:34546:36528:1 gene:ENSDORG00000003985 transcript:ENSDORT00000003985 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGLQTTKWPSHGSFPLKSWLLVFLGLCSQASQLLACPSVCRCDRNFVYCNERSLTSVPLG
IPEGVTVLYLHNNQINNAGFPAGLHHVQSVHTVYLYGNQLDEFPMNLPKNVRVLHLQENN
IQTISRAALAQLLKLEELHLDDNSISTVGVEDGAFREAISLKLLFLSKNHLSSVPVGLPV
DLQELRVDENRIAVISDMAFQNLTSLERLIVDGNLLTNKGIAEGTFSHLTKLKEFSIVRN
SLSRPPPDLPGTHLIRLYLQDNQINHIPLTAFSNLRKLERLDISNNQLRMLTQGVFDNLS
NLKQLTARNNPWFCDCSIKWVTEWLKYIPSSLNVRGFMCQGPEQVRGMAVRELNMNLLSC
PATTPGLPLFTPAPTTLLPTTQPPTLSVPTPSRGHTPPAPTTSKPPTIPDWDGRERATPP
ISERIQLSIHFVNDTSIQVSWLSLFTVMAYKLTWVKMGHSLVGGIVQERIVSGEKQHLSL
VNLEPRSTYRICLVPLDAFNYRTVEDTICSEATTLASYLNNGSNTASSHEQTTSHSMSSP
FLLAGLIGGAVIFVLVVLLSVFCWHMHKKGRYTSQKWKYNRGRRKDDYCEAGTKKDNSIL
EMTETSFQIVSLNNDQLLKGDFRLQPIYTPNGGINYTDCHIPNNMRYCNSSVPDLEHCHT
Download sequence
Identical sequences A0A1S3F8X4
ENSDORP00000003719 XP_012873108.1.60039 ENSDORP00000003719

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]