SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000003803 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000003803
Domain Number 1 Region: 7-264
Classification Level Classification E-value
Superfamily Ankyrin repeat 6.89e-62
Family Ankyrin repeat 0.0000421
Further Details:      
 
Domain Number 2 Region: 551-620
Classification Level Classification E-value
Superfamily SAM/Pointed domain 1.71e-18
Family SAM (sterile alpha motif) domain 0.0067
Further Details:      
 
Domain Number 3 Region: 483-548
Classification Level Classification E-value
Superfamily SAM/Pointed domain 4.52e-16
Family SAM (sterile alpha motif) domain 0.0046
Further Details:      
 
Domain Number 4 Region: 267-346
Classification Level Classification E-value
Superfamily SH3-domain 0.000000000000013
Family SH3-domain 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000003803   Gene: ENSDORG00000004070   Transcript: ENSDORT00000004071
Sequence length 1199
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_5677:108830:120184:-1 gene:ENSDORG00000004070 transcript:ENSDORT00000004071 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGREQDLILAVKNGDVTCVQKLVAKVKAAKTKLLGSTKRLNVNYQDADGFSALHHAALGG
SLELIALLLEAQATVDIKDSNGMRPLHYAAWQGRLEPVRLLLRASAAVNAASLDGQIPLH
LAAQYGHYEVSEMLLQHQSNPCLVNKAKKTPLDLACEFGRLKVAQLLLNSHLCVALLEGE
AKDPCDPNYTTPLHLAAKNGHREVIRQLLRAGIEINRQTKTGTALHEAALYGKTEVVRLL
LEGGVDVNIRNTYNQTALDIVNQFTTSQASREIKQLLREASGILKVRALKDFWNLHDPTA
LNVRAGDVITVLEQHADGRWKGHIHESQRGTDRVGYFPPGIVEVVSKRVGIPVPRVPSAP
TTLRPGFSRTPQPPADDALHPLAYGQLPRVGLSPDSPAGDRNSVGSEGSVGSIRSAGSGQ
SSEGTNGHSTGLLIENAQPLPSAGEDQVLPGLHAPPLADTLSHHPLISHRSGEIFTQDVR
PEQLLEGKDAQAIHNWLSEFQLEGYTAHFLQAGYDVPTISRMTPEDLTAIGVTKPGHRKK
IAAEIAQLSISEWLPNYIPTDLLEWLSALGLPQYHKQLVSSGYDSMGLVADLTWEELQEI
GVNKLGHQKKLMLGVRRLAELRRGLLQGEALGEGGRRLARGSELMTIDGLENGEGPAMAG
PRLLTFQGSELSPELQAAMAGGGPEPLPLPPARSPSQESIGARSRGSGHSQEQSAPQPSA
GGDPGTLQERNLPEGTERPSKLCFPPPGQGPAPYVFMYPQVSPSSPAPGPPPGAPRAFSY
LAGPLATPPDPPRPKRRSHSLSRPGPAEGEAEGEAEEPVGSALGSYATLTRRPGRSTLAR
TSPSPAPARGTPRSQSFALRARRKGPPPPPPKRLSSVSGSTEPPPLDGSPGPKDGATGPR
RRTLSEPSGPSEPPSLPSPAGPVSDTEEEPSPEGTPPSRGSSGEGLPFAEEGNLTIKQRP
KPAGPPPRETPVPPGLHFNLTESDTVKRRPKCREREPLQTALLAFGVAGATPSPSAPPPS
QAPSESSLSESSSPPQPEPSSLATQGAPVPPLSPAPRPVASSAGPSLESSANHRPPAEPE
HTAAPTALLKVPGAGTAPKAVSVACTQLAFSGPKLAPRPGPRPVPPPRPESTGGAVGPGR
AQQRLEQTSSSLAAALRAAEKSIGAEEREGPPGTSTKHILDDISTMFDALADQLDAMLD
Download sequence
Identical sequences ENSDORP00000003803 ENSDORP00000003803

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]