SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000003816 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000003816
Domain Number 1 Region: 67-322
Classification Level Classification E-value
Superfamily L domain-like 4.68e-28
Family Ngr ectodomain-like 0.0058
Further Details:      
 
Domain Number 2 Region: 575-657
Classification Level Classification E-value
Superfamily Fibronectin type III 7.46e-17
Family Fibronectin type III 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000003816   Gene: ENSDORG00000004085   Transcript: ENSDORT00000004085
Sequence length 737
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_2470:6248:21106:-1 gene:ENSDORG00000004085 transcript:ENSDORT00000004085 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQWTLLLLILPWLHQTLGRPSQQRVPLFRLTQRNPRDDGDSDATDSPCKGLSPTGPTLTL
ENRGLHLPGCLPRTLRSLDASHNLLRALSAPELGHLPELQELSLRHXXXXXXXXXXXXXX
XXXXXXXXXXXLAELPPCARPALRRLLVLALAGNPLQVLRPRAFACFPALRRLNLSSSAL
GRGDQGGIAEAAFTGAAGQPLATLEVLDLSGTDLERVESGWIRDLPMLTSLYLRKMPRLR
ILEGDIFKMTPNLRLLDCQNSPTLTSVYTHIFQDTPCLQMLLLQNCNLSSFPPWTVNSSQ
GLSVSLFGNPLICSCELSWLLMDANRTFLSRAADTVCTPAVGFESPFSAPVSLSQLPGMC
KSSQNTTPLASTLHPFHSSAYISSTQGLSTEQSIDRSVQPTGGQQSITKAPYHTVAPLTQ
ASWMLKDAGKGTTPSTTNFIASDSNGNGPPRAASTAGSERGEHADRLSLEPGTSPASLPL
TSKHRDPFPTSGKSTSTSQPHQRTQGPHLSTQEVKIPVFLLDDYYEEEEGSKEELRATHQ
NVLCDYHPCKHLQTPCAELQRRSRCLCPGLSREDTIPDPPKLQAVLEMTDSSALIHWCAP
NSVVVGYQIHYSAEGTAENHSVVDIYATARQHPLYGLSPGTTYHVCVLAANRAGLSLLPA
SGWRRPCTTFTTRPSSLGIFAGLCATSGLLLVSTLVLALCLCRQCHTLNRQNSDTPLVAF
KNLIFDNKPLNSQTISE
Download sequence
Identical sequences ENSDORP00000003816 ENSDORP00000003816

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]