SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000004021 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000004021
Domain Number 1 Region: 151-425
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 6.6e-50
Family Protein kinases, catalytic subunit 0.0000000326
Further Details:      
 
Domain Number 2 Region: 22-133
Classification Level Classification E-value
Superfamily PH domain-like 8.66e-22
Family Pleckstrin-homology domain (PH domain) 0.00000276
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000004021   Gene: ENSDORG00000004303   Transcript: ENSDORT00000004303
Sequence length 497
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_2065:1624:189426:-1 gene:ENSDORG00000004303 transcript:ENSDORT00000004303 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AAAENSNPKADFSSLGQRGAIMSDVTIVKEGWVQKRGEYIKNWRPRYFLLKTDGSFIGYK
EKPQDVDLPYPLNNFSVAKCQLMKTERPKPNTFIIRCLQWTTVIERTFHVDTPEEREEWT
EAIQAVADRLQRQEEERMNCSPTSQIDNIGEEEMDASTTHHKRKTMNDFDYLKLLGKGTF
GKVILVREKASGKYYAMKILKKEVIIAKXXXXXXXXXXXXXXXXXXXXXXSLKYSFQTKD
RLCFVMEYVNGGEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLENLML
DKDGHIKITDFGLCKEGITDAATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEM
MCGRLPFYNQDHEKLFELILMEDIKFPRTLSSDAKSLLSGLLIKDPNKRLGGGPDDAKEI
MRHSFSGVNWDVYDKKLVPPFKPQVTSETDTRCFDEEFTAQTITITPERYDEDGMDGVDN
ERRPHFPQFSYSASGRE
Download sequence
Identical sequences ENSDORP00000004021 ENSDORP00000004021

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]