SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000004404 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000004404
Domain Number 1 Region: 1469-1521
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000092
Family Classic zinc finger, C2H2 0.017
Further Details:      
 
Domain Number 2 Region: 1376-1424
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000136
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 3 Region: 1429-1484
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000147
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 4 Region: 355-407
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000137
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 5 Region: 396-447
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000272
Family Classic zinc finger, C2H2 0.019
Further Details:      
 
Domain Number 6 Region: 1106-1158
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000967
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 7 Region: 117-166
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000682
Family Classic zinc finger, C2H2 0.039
Further Details:      
 
Domain Number 8 Region: 1501-1555
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000121
Family Classic zinc finger, C2H2 0.028
Further Details:      
 
Domain Number 9 Region: 156-214
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000105
Family Classic zinc finger, C2H2 0.018
Further Details:      
 
Domain Number 10 Region: 789-839
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000143
Family Classic zinc finger, C2H2 0.03
Further Details:      
 
Domain Number 11 Region: 1169-1217
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000296
Family Classic zinc finger, C2H2 0.044
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000004404
Domain Number - Region: 1332-1367
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000464
Family Classic zinc finger, C2H2 0.027
Further Details:      
 
Domain Number - Region: 207-233
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000587
Family Classic zinc finger, C2H2 0.077
Further Details:      
 
Domain Number - Region: 499-548
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000674
Family Classic zinc finger, C2H2 0.035
Further Details:      
 
Domain Number - Region: 1239-1286
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0007
Family Classic zinc finger, C2H2 0.042
Further Details:      
 
Domain Number - Region: 1084-1115
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00363
Family Classic zinc finger, C2H2 0.027
Further Details:      
 
Domain Number - Region: 438-474
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0059
Family Classic zinc finger, C2H2 0.024
Further Details:      
 
Domain Number - Region: 1015-1037
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0225
Family Classic zinc finger, C2H2 0.025
Further Details:      
 
Domain Number - Region: 299-347
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.09
Family Classic zinc finger, C2H2 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000004404   Gene: ENSDORG00000004707   Transcript: ENSDORT00000004707
Sequence length 1597
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_1971:21169:40632:-1 gene:ENSDORG00000004707 transcript:ENSDORT00000004707 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PSTCAWGPTPLADSGCLVEATATEESGNMEIIVETVAGTLSPGAPGETPXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDVTSGTESLFKTHM
CSECKRCFKKRTHLVEHLHLHFPDPSLQCPNCQKFFTSKSKLKTHLLRELGEKAHRCPLC
HYSAVERNALNRHMASMHEDISNFYSDTYACPVCREEFRLSQALKEHLKSHTAAAAAEPS
PLRCFQEDCSFAAPDRKTFIKHLKETHGVRAVECRHHSCPMLFATAEAMEAHHKSHYAFH
CPHCDFACSNKHLFRKHKKQGHPGSEELQCTFCPFATFNPVAYQDHVGKMHAHEKIHQCP
ECNFATAHKRVLIRHMLLHTGEKPHKCELCDFTCRDVSYLSKHMLTHSNTKDYMCTECGY
VTKWKHYLSVHMRKHAGDLRYQCNQCSYRCHRADQLSSHKLRHQGKTLMCEVCAFACKRK
YELQKHMASQHHAGTPAPLYPCRYCSYQSRHKQALLSHECKHTRLREFHCALCDYRTFSN
TTLFFHKRKAHGYVPGEQILQFHSASLESEGTRQCLEPPPDSEPSSQLSSQPQEPGHEHE
TVVDPSLDQTLPETRDDISTRRQESEAPHGDGLEGSASPGEVEEGGCTLHLEALGVELEP
VAEPPLEELTETAPVEFRPLELDGPDGLEGQALSHCECVGTPSLGTEEEPTPEKSVPEPP
GNPPLLEEAPNSWVGTLKATPCAEMTPSPQFPESESLLKVLRRQDKEQAEALVLEGRVQM
VVIQGEGQAFRCPHCPFITRREKALKLHSRSGCQGRREPLLCPECGASFKQQRGLSTHLL
KKCPVLLRKNKGLPRPPSPTALHTQLPATQASEDTKSVKPALVPSEAELELPKAVPELPG
EPGDQEELLATPSGSPAPPIGNTSSAESPEKFHFDQGKFHCNSCTFLCSRLSSITSHVTE
GCRGRGRRGKRGSSHTRPAVSSVSSGDTAPLSNRSPESNNPGGGDASLTEKPKGPLFCPT
CPFSCQQERALRTHQTQGCPLGKPRDLHCGLCPFTAPAATALRLHQKRRHPTANAARGPR
PALQCADCGFTCKQSRCLQQHRRLKHEGVKPHQCPFCDFSTTRRYRLEAHQSRHTGVGRI
PCSSCSQTFGTNSKLRLHRLRVHDKTPTHFCPLCDYSGYLRHDITRHVNSCHQGTPAFSC
TQCEAQFSSETALKQHALRRHPESTQPAPGSAAEASEGPLHCSHCGLLCPSPASLRGHTR
KQHPRLECGACQEAFSSRLALDEHRRQQHFSHRCQLCDFAARERVGLVKHYLEQHEETSA
AASDGDRDASQPPLHCPFCDFACRHQLVLDHHVKGHGGTRLYKCTDCAYSTKNRQKITWH
SRIHTGEKPYRCHLCPYACADPSRLKYHMRIHKEERKYLCPECGYKCKWVNQLKYHMTKH
TGLKPYRCPECEYRTNRADALRVHQETRHREARAFMCEQCGKAFKTRFLLRTHLRKHSEA
KPYVCNVCHRAFRWAAGLRHHALTHTDRHPFFCRLCSYKAKQKFQVVKHVRRHHPDQADP
NQGVGKDPTTPTVHLHDVKLENPSPPAPAVPTTGPEG
Download sequence
Identical sequences ENSDORP00000004404 ENSDORP00000004404

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]