SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000004506 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000004506
Domain Number 1 Region: 30-203
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.4e-74
Family Ephrin receptor ligand binding domain 0.000000877
Further Details:      
 
Domain Number 2 Region: 632-779
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.78e-43
Family Protein kinases, catalytic subunit 0.000000416
Further Details:      
 
Domain Number 3 Region: 328-532
Classification Level Classification E-value
Superfamily Fibronectin type III 4.61e-40
Family Fibronectin type III 0.00013
Further Details:      
 
Domain Number 4 Region: 910-981
Classification Level Classification E-value
Superfamily SAM/Pointed domain 8.64e-21
Family SAM (sterile alpha motif) domain 0.0000422
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000004506
Domain Number - Region: 259-330,366-389
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000188
Family Growth factor receptor domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000004506   Gene: ENSDORG00000004817   Transcript: ENSDORT00000004817
Sequence length 986
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_2011:199806:338433:-1 gene:ENSDORG00000004817 transcript:ENSDORT00000004817 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGVFYVVLFSCLFGICDAVTGSRVYPANEVTLLDSRSVQGELGWIASPLEGGWEEVSIM
DEKNTPIRTYQVCNVMEPSQNNWLRTDWITREGAQRVYIEIKFTLRDCNSLPGVMGTCKE
TFNLYYYESDNDKERFIRESQFGKIDTIAADESFTQVDIGDRIMKLNTEIRDVGPLSKKG
FYLAFQDVGACIALVSVRVFYKKCPLTVRNLAQFPDTITGADTSSLVEVRGSCVNNSEEK
DVPKMYCGADGEWLVPIGNCLCNAGHEEQNGECQACKIGYYKALSTDATCAKCPPHSYSV
WEGATSCTCDRGFFRADNDAASMPCTRPPSAPLNLISNVNETSVNLEWSSPQNTGGRQDI
SYNVVCKKCGAGDPSKCRPCGSGVHYTPQQNGLKTTRVSITDLLAHTNYTFEIWAVNGVS
KYNPSPDQSVSVTVTTNQAAPSSIALVQAKEVTRYSVALAWLEPDRPNGVILEYEVKYYE
KDQNERSYRIVRTAARNTDIKGLNPLTSYVFHVRARTAAGYGDFSEPLEVTTNTVPSRII
GDGANSTVLLVSVSGSVVLVVILIAAFVISKRRSKYSKAKQEADEEKHLNQXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEFGEVCSGRLKVPGKREICVAIKTLKAGYT
DKQRRDFLSEASIMGQFDHPNIIHLEGVVTKCKPVMIITEYMENGSLDAFLRKNDGRFTV
IQLVGMLRGIGSGMKYLSDMSYVHRDLAARNILVNSNLVCKVSDFGMSRVLEDDPEAAYT
TRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPNT
ALLDPSSPEFSAVVSVGDWLQAIKMDRYKDNFTAAGYTTLEAVVHMNQDDLARIGITAIT
HQNKILSSVQAMRTQMQQIHGRMVPV
Download sequence
Identical sequences ENSDORP00000004506 ENSDORP00000004506

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]