SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000004702 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000004702
Domain Number 1 Region: 759-869,906-956
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.26e-40
Family Ankyrin repeat 0.00038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000004702   Gene: ENSDORG00000005026   Transcript: ENSDORT00000005027
Sequence length 1661
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_646:12307:130810:-1 gene:ENSDORG00000005026 transcript:ENSDORT00000005027 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATDGASCEPDLSRAPEDAAGATAEAAKKEFDVDTLSKPELRMLLSVMEGELEARDLVIE
ALRARRKEVFIQERYGRFNLNDPFLALQRDYEASSSDKEKKPVCTNPLSILEAVMAHCRK
MQERMSAQLAAAESRQKKLEMEKLQLQALEQEHKKLAERLEEERGKNKHVVLMLVKECKQ
LSGKVIEEAQRLEEVMAKLEEEKKRTNELEEELSAEKRRSTEMEAQMEKQLSEFDTEREQ
LRAKLSREEAHTADLKEEIDKMKKMIEQLKRGNDSKPSLSLPRKTKDRRLVSISVGTEGP
VTKSVACQTELVMESTDHGRKLPLTVPVKPSTGSPLVSANTKGNVCPNPPLVRPGIDRQA
SHGDLIGSSLPTPPTPSASRIEENGPSTGSTPDLTSSTSPVPGNAAPPTTPTPAIAPQNY
PQAPPMHSLHSPCANVSLHPGLNPRIQAARFRFQGNANDPDQNGNTTQSPPPRDVSPTSR
DSLVAKQLARNTVTQALSRFTSPQPGASPRPGVSPTGDSGTYNPVSRTSLKTPGVARVDR
GNPPPIPPKKPGLSQTPSPPHPQLKVIMDSSRAANTGAKVDNKAVASPPSTLPQGNRVIS
EENLPKSTSPQLPPKPSIDLTVAPAGCAVSALATSQVGAWPAEIPGLNQPACSDNSLVIP
TTIAFCSSIRPVSASSRRPGASGSLLVTASGWSPSLTPLLMSGGXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXCVRLLLNVEAQVDAADKNGFT
PLCAAAAQGHFECVELLIAYDANIDHAAAGGLTPLYLACKHGNKECIRLLLEAGSDRSVE
TRDGWTPVHAAVDTGNVDSLKLLMYHRVPARGNSLHEEEPKLGFTLEGGEESPEDTSKPV
VPADLINHADREGWTAAHIAASKGFKNCLEILCRHGGLEPEKRDKCNRTVHDVATDDCKH
LLENLNALKIPLRISVGEIPPGNGGSDDLECENTVCALNIRKQTSWDDFSKAVSQALTNH
FQAISADGWWSLEDVTLNNTTDSNIGLGASSIRSITLGNVPWSAGQSFSQSPWDFVRKAK
VEQVTVLLSGPQEGSLSSVTYASMIPLQMLQNYLRLVEQYHNVIFHGPEGSLQDYIAYQL
ALCMKHRQMAAGFACEIVRAEVDAGFSKEQLIDLFISSXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPVCKIVDWVLSVWRQLNS
CLARLGTSEALLGPKYFLSCPVVPGHAQATVKWMSKLWNAVIAPRVQEAILSRACVKRQP
GPVQAAAKKHPSQGQQAVVKAALSILLNKAVLHGCPLPRAELEQHTADFKGGNFPLSIVS
SYSKKKGESGAWRKVNTSPRKKPGRFPSPTWSKPDLSQEGIKNKTTPQLNCNRNTSLSKQ
KTEEHDHSLLLILHDRFSLGSDDEADLVKELQSMCSSKSESDISKIADSRDDLRSFDKSA
NSPAFSAPVNNPSTPVSQKEASPRSSHQITECSNSKSKTELGVSRVKSFLPVPRSKIAQC
SQNTKRSSSSSNTRQLEINNNSKEENWNLHKHEPVEKPNKY
Download sequence
Identical sequences ENSDORP00000004702 ENSDORP00000004702

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]