SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000005207 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000005207
Domain Number 1 Region: 38-127
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 2.11e-31
Family SCAN domain 0.00011
Further Details:      
 
Domain Number 2 Region: 372-405
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000052
Family Classic zinc finger, C2H2 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000005207   Gene: ENSDORG00000005565   Transcript: ENSDORT00000005566
Sequence length 453
Comment pep:novel scaffold:dipOrd1:scaffold_26652:5985:11646:1 gene:ENSDORG00000005565 transcript:ENSDORT00000005566 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLPLEKVLASPRSSPLPPETPTLGSDNTVQQAEERTPADLEFSRLRFREFVYQETAGPHQ
TLARLHDLCRQWLRPDACSKEEILELLVLEQFLGILPDRVRPWVVSQYPENCTKAASLVE
GISDVLEEPGIRLCSPGGSTSSFSDGDYERHSDPLLLPRGLLSPSGDPDTGEWPALESMH
LDQENLGREKSEESDIDATEPKTESLPDETLALGEWNQIDPTEENLKSYEKLLLSGYELS
QPCTAFVLEAEDLEELPGGRLQDGGRIQSREACEMSAYRMLMERLTGGAPANPLLDAQGA
QNGESSSASRSQRQSVIRQPAARRPTARLGKRPHPNDEDELGPKYSSSAASSTGKVAWLD
PGVDEPGVCTGEPYTCSECGDTFAWISQLIEHHRSHSSKKRFACGCQETLSVPALVHKTQ
DKENGSVWSPLPATVAPALAGGSPPRTPHMQEP
Download sequence
Identical sequences ENSDORP00000005207 ENSDORP00000005207

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]