SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000005372 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000005372
Domain Number 1 Region: 436-492
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.87e-24
Family Classic zinc finger, C2H2 0.0036
Further Details:      
 
Domain Number 2 Region: 295-352
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.59e-24
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 3 Region: 379-436
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.8e-23
Family Classic zinc finger, C2H2 0.0065
Further Details:      
 
Domain Number 4 Region: 575-632
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.4e-23
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 5 Region: 3-61
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 2.09e-22
Family KRAB domain (Kruppel-associated box) 0.0014
Further Details:      
 
Domain Number 6 Region: 239-296
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.75e-22
Family Classic zinc finger, C2H2 0.0065
Further Details:      
 
Domain Number 7 Region: 519-576
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.76e-22
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 8 Region: 617-669
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.3e-19
Family Classic zinc finger, C2H2 0.0042
Further Details:      
 
Domain Number 9 Region: 482-514
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000286
Family Classic zinc finger, C2H2 0.0065
Further Details:      
 
Domain Number 10 Region: 342-374
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000305
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000005372
Domain Number - Region: 206-253
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00589
Family Classic zinc finger, C2H2 0.031
Further Details:      
 
Domain Number - Region: 134-179
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0305
Family Classic zinc finger, C2H2 0.062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000005372   Gene: ENSDORG00000005742   Transcript: ENSDORT00000005740
Sequence length 687
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_6678:18308:22254:-1 gene:ENSDORG00000005742 transcript:ENSDORT00000005740 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IMEPLSFNDVAVGFTQEEWQQLGADEKTTYRDVMLENYSHLVSLGYQIIKPDVITKLEQG
EEPWIVEGAFVHQRYPDEVWRENNLMNRAWEGKAKHSRPPVFYKNKSLVGEGSSVSGKAF
SVEKNLVPRKIASKCDLCEKSLACVPEYISSDGSYASMKPSECSGCGKSLLHMKPQKAHP
GGFNQNGDAYTLNEENFYQKIHILEKPFEYIDCQKAFPKDPVFNHVDEKSYNWNASEMAF
LQMSDLNVHQRPHMEMKPYECRECGKSFCKKSKFIIHQRTHTGEKPYKCNQCGKSFCQKG
TLTVHQRTHTGEKPYECTECGKNFYQKLHLIQHQRTHSGEKPYECSYCGKSFCQKTHLTQ
HQRTHSGERPYVCHDCGKTFSQKSALNDHQKIHTGVKLYKCSECGKCFCRKSTLTTHLRT
HTGEKPYECNECGKFFSRLSYLTVHYRTHSGEKPYECADCGKTFYLNSALMRHQRVHTGE
KPYECNECGKLFSQLSYLTIHHRTHSGVKPYECSECGKTFYQNSALCRHRRIHRGEKPYE
CYICGKFFSQMSYLTIHHRIHSGEKPYECRECGKTFCQNSALNRHQRTHTGEKAYECYEC
GKCFSQMSYLTIHHRIHSGEKPFECNECGKAFSRMSYLTVHYRTHSGEKPYECMECGKKF
YHKSAFNSHQRIHRRGNVDVVDVGRLL
Download sequence
Identical sequences ENSDORP00000005372 ENSDORP00000005372

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]