SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000005559 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000005559
Domain Number 1 Region: 1-112
Classification Level Classification E-value
Superfamily PH domain-like 4.72e-24
Family Pleckstrin-homology domain (PH domain) 0.000000958
Further Details:      
 
Domain Number 2 Region: 137-215
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 0.0000000000000108
Family Protein kinases, catalytic subunit 0.0000388
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000005559   Gene: ENSDORG00000005935   Transcript: ENSDORT00000005935
Sequence length 461
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_3469:5717:28392:-1 gene:ENSDORG00000005935 transcript:ENSDORT00000005935 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNDGAIVKEGWLHKRGEYIKTWRPRYFLLKSDGTFIGYKERPQDVDQRESPLNNFSVAQC
QLMKTERPRPNTFIIRCLQWTTVIERTFHVETPEEREEWTTAIQTVADGLNRQEETMDFR
SGSPSDNSGAEEMEVSLAKPKHRVTMNEFEYLKLLGKGTFGKVILVKEKADEVAHTLTEN
RVLQNSRHPFLTALKYSFQTHDRLCFVMEYANGGEXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLSPPFKPQVTSETDTRYFD
EEFTAQMITITPPDQDDSMECVDSERRPHFPQFSYSASGTA
Download sequence
Identical sequences ENSDORP00000005559 ENSDORP00000005559

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]