SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000005715 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000005715
Domain Number 1 Region: 222-478
Classification Level Classification E-value
Superfamily NAD kinase/diacylglycerol kinase-like 6.32e-33
Family Diacylglycerol kinase-like 0.012
Further Details:      
 
Domain Number 2 Region: 820-879
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.000000000205
Family Ankyrin repeat 0.0044
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000005715
Domain Number - Region: 27-55
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.0262
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000005715   Gene: ENSDORG00000006104   Transcript: ENSDORT00000006104
Sequence length 895
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_1447:115306:374129:-1 gene:ENSDORG00000006104 transcript:ENSDORT00000006104 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ENAINGEHLWLETNVSGDLCYLGEENCQVRFAKSALRRKCAVCKIVVHTACIEQLEKINF
RCKPTFREGGSRSPRENFVRHHWVHRRRQEGKCKQCGKGFQQKFSFHSKEIVAISCSWCK
QAFHNKVTCFMLHHIEEPCSLGAHAAVIVPPTWIIKVKKPQXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGTKVLQMFMWYLNPRQVFDLS
QEGPKDALELYRKVPNLRILACGGDGTVGWILSILDELQLSPQPPVGVLPLGTGNDLART
LNWGGGYTDEPVSKILCQVEDGTIVQLDRWNLHVERNPDLPPEELEDGVCKLPLNVFNNY
FSLGFDAHVTLEFHESREANPEKFNSRFRNKMFYAGAAFSDFLQRSSRDLSKHVKVVXXX
XXXXXXXXXXXXXXXXXXXXXXYCAGTMPWGNPGDHHDFEPQRHDDGYIEVIGFTMASLX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXPQSVPDRLRIRVNKISLQDYEGFHYDKEKLREAXXXXXXXXXXXXXXXXXXXIP
LGILVVRGDCDLETCRMYIDRLQEDLQSVSSGSQRVHYQDHETSFPRALSAQRLSPRWCF
LDDRSQEHLHFVMEISQDEIFILDPDMVVSQQAGTPPGMPDLVVEQASGLTDWWNPTLRK
RMLSDSGLGMIPPHYEDSDMKDLSHSRGLXXXXXXXXXXILQAVVAGDLMKXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPSELLDMADSETGETALHKAACQRNRAV
CQLLVDAGASLRKTDSKGKTPQDRAQQAGDPDLAAYLESRQNYKLIGHEDLETAV
Download sequence
Identical sequences ENSDORP00000005715 ENSDORP00000005715

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]