SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000005847 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000005847
Domain Number 1 Region: 413-470
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.34e-23
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 2 Region: 470-526
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.88e-21
Family Classic zinc finger, C2H2 0.013
Further Details:      
 
Domain Number 3 Region: 2-56
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 5.23e-19
Family KRAB domain (Kruppel-associated box) 0.0014
Further Details:      
 
Domain Number 4 Region: 375-427
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.38e-16
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 
Domain Number 5 Region: 300-357
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000299
Family Classic zinc finger, C2H2 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000005847   Gene: ENSDORG00000006247   Transcript: ENSDORT00000006246
Sequence length 534
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_5793:5446:11553:-1 gene:ENSDORG00000006247 transcript:ENSDORT00000006246 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GLVSFEDVILHFSPEEWELLDEAQKLLYCDVMLENFALLASLGLTAFRSHVVARLEMENK
PWIPDRGAMTSAMARGVCGTDFCQGTEGRQHFSGYSVPGEGASQQRSPKMALCIRKAYLC
GLTLKDTFHLGHYQATLPNQKPMKVGVNNTGLELHACPPLGQGAQPNPATCVRGEESRAF
LMKPDTGSPSEKPFAHRKIRGDFVADFMATTGFLAPQITPWAKEGLARAPAIQMHDQISE
FGDTLSDKSTPIQDMRVHTQERPWEWIKSGLFLPPATSSLPSQNIDGRAPPSDGRQYGSS
FSQPSSLIHLDMVSSSENTSEWSTYGKSFSWNSSLTNPQKVHSREAPSECPDRGEFFSHL
DLIPHQQVPSSESRRPFACGECGMFFSQRGALRKHQKIHTGTRTFGCSECGKVFTRSSDL
MKHHRVHTGERPYECSECGKFFSQTSSLNSHRRLHTGEKPFQCNECGKFFNQSSSLHNHR
RLHSEERPYRCGECGKTFRQMSNLRQHQKIHKPDKPYHCKECGKAFSQLPTMRH
Download sequence
Identical sequences ENSDORP00000005847 ENSDORP00000005847

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]