SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000005871 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000005871
Domain Number 1 Region: 1-81
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 4.99e-21
Family THAP domain 0.00000371
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000005871
Domain Number - Region: 132-203
Classification Level Classification E-value
Superfamily Translin 0.0109
Family Translin 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000005871   Gene: ENSDORG00000006270   Transcript: ENSDORT00000006271
Sequence length 221
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_3302:236569:245819:1 gene:ENSDORG00000006270 transcript:ENSDORT00000006271 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPTNCAAAGCATTYNKHINVSFHRFPLDPKREEWIRLVRRKNFVPGKHTFLCSKHFEASC
FDLTGQTRRLKMDAVPTIFDFCTHIESVKLKSRNLLKRNDSCTTAGPSNFKSNISSQQVL
LEHSYAFRNPMEAKKRIIKLEKEIASLRRKMKTCLQKERRATQRWIKATCFVKNLEANNL
LPKGTLEHILPTASSIPLEDFILQDQYKTMISLNLKPTNCI
Download sequence
Identical sequences ENSDORP00000005871 ENSDORP00000005871

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]