SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000006252 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000006252
Domain Number 1 Region: 49-518
Classification Level Classification E-value
Superfamily Sema domain 1.01e-128
Family Sema domain 0.0000195
Further Details:      
 
Domain Number 2 Region: 1727-1869
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.96e-19
Family p120GAP domain-like 0.039
Further Details:      
 
Domain Number 3 Region: 961-1050
Classification Level Classification E-value
Superfamily E set domains 2.92e-18
Family Other IPT/TIG domains 0.086
Further Details:      
 
Domain Number 4 Region: 1360-1489,1526-1551
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.02e-17
Family p120GAP domain-like 0.015
Further Details:      
 
Domain Number 5 Region: 1049-1152
Classification Level Classification E-value
Superfamily E set domains 5.47e-16
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.054
Further Details:      
 
Domain Number 6 Region: 865-962
Classification Level Classification E-value
Superfamily E set domains 0.00000000000152
Family Other IPT/TIG domains 0.014
Further Details:      
 
Domain Number 7 Region: 521-571
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000000000379
Family Plexin repeat 0.0016
Further Details:      
 
Domain Number 8 Region: 1149-1230
Classification Level Classification E-value
Superfamily E set domains 0.000000077
Family E-set domains of sugar-utilizing enzymes 0.044
Further Details:      
 
Domain Number 9 Region: 817-851
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000445
Family Plexin repeat 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000006252   Gene: ENSDORG00000006671   Transcript: ENSDORT00000006671
Sequence length 1900
Comment pep:novel scaffold:dipOrd1:scaffold_96:34740:228649:-1 gene:ENSDORG00000006671 transcript:ENSDORT00000006671 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TGRNCLLSIAPFRMEQRRPWPWADSWSVVLLSLVWVLLTPSAAGMPQFSTFHSENRDWTF
NHLTVHRGTGAVYVGAINRVYKLTGNLTIQVAHKTGPEEDNKSCYPPLIVQPCSEVLTLT
NNVNKLLIIDYSENRLLACGSLYQGVCKLLRLDDLFILVEPSHKKEHYLSSVNKTGTMYG
VIVRSEGEDGKLFIGTAVDGKQDYFPTLSSRKLPRDPESSAMLDYELHSDFVSSLIKIPS
DTLALVSHFDIFYIYGFASGGFVYFLTVQPETPEGVAINSAGDLFYTSRIVRLCKDDPKF
HSYVSLPFGCTRAGVEYRLLQAAYLAKPGAALAQAFNISSQDDVLFAIFSKGQKQYHHPP
DDSALCAFPIRAVNLQIKERLQSCYQGEGNLELNWLLGKDVQCTKAPVPIDDNFCGLDIN
QPLGGSTPVEGLTLYTTSKDRMTSVASYVYNGYSVVFVGTKSGKLKKIRADGPPHGGVQY
EMVSVLKDGSPILRDMAFSIDQRYLYVMSERQVTRVPVESCEQYTTCGECLSSGDPHCGW
CALHNMCSRRDKCQRAWEPNRFAASISQCLSVAVQPGSISVSEHSQLLSLVVSDAPDLSA
GISCAFGNLTEVEGKVSGSQVLCVSPGPRDVPTIPLDQDWFGLELQLRSKETGKIFVSTE
FKFYNCSAHQLCLSCVNSAFRCHWCKYRNLCTHDPTTCSFQEGRINISEDCPQLVPTEEI
LIPVGEVKPITLKARNLPQPQSGQRGYECVLNIQGAIHRVPALRFNSSSVQCQNSSYQYD
GMDISNLAVDFAVVWNGNFIIDNPQDLKVHLYKCAAQRESCGLCLKADRKFECGWCSGER
RCTLHQHCTSPSSPWLDWSSHNVKCSNPQITEILTVSGPPEGGTRVTIHGVNLGLDFSEI
AHHVQVAGVPCTPLPGEYIIAEQIVCEMGHALIGTTSGPVRLCIGECKPEFMTKSHQQYT
FVNPSVLSLNPIRGPESGGTMVTITGHYLGAGSSVAVYLGNQTCEFYGRSMNEIVCVSPP
SSNGLGAVPVSVSVDRARVDNSLQFEYIDDPRVQRIEPEWSITSGHTPLTITGFNLDVIQ
EPRIRVKFNGKESVNVCKVVNTTTLTCLAPSLTTDYRPGLDTVERPDEFGFLFNNVQSLL
VYNDTKFIYYPNPTFELLSPTGVLDQKPGSPIILKGKNLCPPASGGAKLNYTVLIGETPC
AVTVSETQLLCEPPNLTGQHKVMVHVGGMVFSPGSVSVISDSLLTLPAIVSIAAGGSLLL
IIVIIVLIAYKRKSRENDLTLKRLQMQMDNLESRVALECKEAFAELQTDINELTSDLDRS
GIPYLDYRTYAMRVLFPGIEDHPVLRELEVQGNGQQHVEKALKLFAQLINNKVFLLTFIR
TLELQRSFSMRDRGNVASLIMTGLQGRLEYATDVLKQLLSDLIDKNLENKNHPKLLLRRT
ESVAEKMLTDWFAFLLHKFLKECAGEPLFMLYCAIKQQMEKGPIDAITGEARYSLSEDKL
IRQQIEYKTLILNCVNPDNENSPEIPVKVLNCDTITQVKEKILDAVYKNVPYSQRPRAVD
MDLEWRQGRIARVVLQDEDITTKIEGDWKRLNTLMHYQVSDRSVVALVPKQTSSYNIPAS
ASISRTSISRYDSSFYTGSPDSLRSRAPMITPDLESGVKVWHLVKNHDHGDQEGDRGSKM
VSEIYLTRLATGTLQKFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDEQADRHSIHDTDV
RHTWKSNCLPLRFWVNVIKNPQFVFDIHKGSITDACLSVVAQTFMDSCSTSEHRLGKDSP
SNKLLYAKDIPSYKSWVERYYADIAKLPAISDQDMNAYLAEQSRLHAVEFNMLSALNEIY
SYVSKYSEELIGALEQDEQARRQRLAYKVEQLIDAMSIES
Download sequence
Identical sequences ENSDORP00000006252 ENSDORP00000006252

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]