SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000006391 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000006391
Domain Number 1 Region: 46-102
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 3.27e-17
Family KRAB domain (Kruppel-associated box) 0.0024
Further Details:      
 
Domain Number 2 Region: 255-318
Classification Level Classification E-value
Superfamily Homeodomain-like 0.00000000017
Family Centromere-binding 0.01
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000006391
Domain Number - Region: 196-238
Classification Level Classification E-value
Superfamily Homeodomain-like 0.0125
Family Cgl2762-like 0.067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000006391   Gene: ENSDORG00000006822   Transcript: ENSDORT00000006821
Sequence length 609
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_3510:8106:17352:1 gene:ENSDORG00000006822 transcript:ENSDORT00000006821 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MESTTYPLNLTLKEEEEEEEIQCRELKDGPTDMQKVRICSEGGWVPALFDEVAIYFSDEE
WEVLTDQQKALYREVMRMNYETVLSLEFPFPKPDMITRLEREEESHNSEEWQLQGGPVTE
NEESDVKSPDWATPMNTTSHFPQPQHLDSFGLRLPRDITELPEWSEGYPFCMAMGFPGYD
LSADDIAGKFQFSRGMRRSYDAGFKLMVVEYAESTNNCQAAKQFGVFEKNVRDWRKVKPQ
LQNAHAMRRAFRGPKNGRFALVDQRVAEYVRYMQAKGDPITREAMQLKALEIAQEMNIPE
KGFKASLGWCRRMMRRYDLSLRHKVPVPQHLPEDLTEKLITYQRTVLSLRRAHDYEVTQM
GNADETPICLEVPSRVTVDNQGEKPVLVKTPGREKLRITAMLGVLADGKKLPPYIILRGT
YIPPGKFPSGMEIRCHRYGWMTEDLMQDWLEVVWRRRTGALPKQRGMLILNGFRGHATDS
VKSSMESLNTDMVIIPGSLTPQLQVLDVVVYKPLNDSVRAQYSNWLLAGNLALSPTGNAK
KPPLGLFLEWVMVAWNSISSESIVQGFKKCHISSNLEEEDDELWEIESELPGGGEPPKEC
DTESMTEGN
Download sequence
Identical sequences ENSDORP00000006391 ENSDORP00000006391

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]