SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000006409 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000006409
Domain Number 1 Region: 50-135
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 6.87e-33
Family SCAN domain 0.00012
Further Details:      
 
Domain Number 2 Region: 452-504
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.67e-20
Family Classic zinc finger, C2H2 0.0029
Further Details:      
 
Domain Number 3 Region: 413-467
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.92e-20
Family Classic zinc finger, C2H2 0.008
Further Details:      
 
Domain Number 4 Region: 317-369
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.18e-19
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 
Domain Number 5 Region: 355-410
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.9e-19
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 
Domain Number 6 Region: 140-182
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.00000000314
Family KRAB domain (Kruppel-associated box) 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000006409   Gene: ENSDORG00000006843   Transcript: ENSDORT00000006841
Sequence length 511
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_4452:3793:13011:-1 gene:ENSDORG00000006843 transcript:ENSDORT00000006841 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TDSGLTTQSLMAAGSGVPASSLCEGLLVVKVEEDSPRGLGSELPGAWQHLETSRKQFRQL
RYQEVAGPEEALSRLRELCRRWLRPEMHSKEQMVELLVLEQFLSILPDNLRAWVWERGPE
NGDQAAAAARACQTTLDQASSQSSMCLDDVAVSLTWEEWEQLDAAERNICRESTQDYGSP
PVLPSLETRAENERLIPKQENLEDQPQDWLQEMGQGRLPFPECTDICGDGAQKPISLKLT
NPLKEHELTNKRSTQKGVSGDSLKMERPTDDDKHGNKHTSSLAKGKCHWVKPYNPASGSS
VCSSSLSEAHMQRCEERPYKCESCPKAFKQRSDLLKHQRIHTGEKPYECHDCGKSFRQSA
ALIKHHRTHTGEKPYVCPKCGECFRQSSHLNRHQRTHIGKKYCQCEECGEICHVSSLLKH
RRLHKGERPYLCEDCEKSFKQRSDLFKHRRIHTGEKPYGCTMCGKSFSQSATLVKHQRTH
TGEKPYKCLECGESFRQSTHLIRHQRVHNKV
Download sequence
Identical sequences ENSDORP00000006409 ENSDORP00000006409

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]