SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000006413 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000006413
Domain Number 1 Region: 43-133
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 3.3e-37
Family SCAN domain 0.0000713
Further Details:      
 
Domain Number 2 Region: 343-399
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.16e-23
Family Classic zinc finger, C2H2 0.0038
Further Details:      
 
Domain Number 3 Region: 557-609
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.83e-20
Family Classic zinc finger, C2H2 0.0027
Further Details:      
 
Domain Number 4 Region: 388-440
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000339
Family Classic zinc finger, C2H2 0.0078
Further Details:      
 
Domain Number 5 Region: 759-808
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000166
Family Classic zinc finger, C2H2 0.0065
Further Details:      
 
Domain Number 6 Region: 531-567
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000136
Family Classic zinc finger, C2H2 0.0051
Further Details:      
 
Domain Number 7 Region: 221-260
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.00000000000157
Family KRAB domain (Kruppel-associated box) 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000006413   Gene: ENSDORG00000006845   Transcript: ENSDORT00000006845
Sequence length 823
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_4452:16346:28579:1 gene:ENSDORG00000006845 transcript:ENSDORT00000006845 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIMTEFREVIDLDPPSECQEQEGILIVKVEEEEDCTWMQEYNPPTFESFYQRFRHFQYHE
ASGPREALSQLRVLCCEWLRPELHTKEQILELLVLEQFLTILPEEFQAWVREHHPENGEE
AVAVIESIQRDLEERREQIIVCPEALPPKMVLPEVVQESLAHQALSTDPEADQEPLKPHL
LEENALPVLQVPPLPLKDSQELTTSLLSAGSQKLVKIEDVADVAVSFILEEWGHLDPAQK
SLYRDSRKDNYGRITCMDYESKDAVELVVKQISEEAESHWMAPGPAGSGPRGEGVVQRWQ
VSPPAGRSRHSAPPKPGLGTGRVSGAGGGGERGHRCSDCGKFFLQASNFIQHRRIHTGEK
PFRCGECGKSYNQRVHLTQHQRVHTGEKPYACAVCGKAFRVSSHLVQHRSVHSRERPHAC
AQCGKRFGRHSHLVEHLKRHAREKAQRCGDKRAKNTKLSVKKKMSDFAAADTELSGKSQR
DTSEVRNLGDGYDPQGPGERTPGLPRKELPGQPPTKRMHGGDVPKKLSPAGERPHKCGDC
GKSFIQSAHLIQHRRIHTGEKPFRCDECGKSYNQRVHLTQHQRVHTGEKPYACAVCGKAF
RVRSHLVQHQSVHSAEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXHQCPECGKSFALKSHLSQHQRI
HTGEKPQCKECGVSFSWSGSLLKHLRSHERTDPRSPFSVASLP
Download sequence
Identical sequences ENSDORP00000006413 ENSDORP00000006413

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]