SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000006568 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000006568
Domain Number 1 Region: 334-740
Classification Level Classification E-value
Superfamily Phosphofructokinase 2.75e-97
Family Phosphofructokinase 0.0000258
Further Details:      
 
Domain Number 2 Region: 25-341
Classification Level Classification E-value
Superfamily Phosphofructokinase 1.44e-77
Family Phosphofructokinase 0.00000144
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000006568   Gene: ENSDORG00000007006   Transcript: ENSDORT00000007006
Sequence length 772
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_3457:4130:23034:1 gene:ENSDORG00000007006 transcript:ENSDORT00000007006 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
WDSWNLSGHESSPGHDADLQVHRSMNAAVRAVTRMGIYVGAKVLIYEGYEGLVEGGENIK
PANWLSVSNIIQLGGTIIGSARCKAFTTREGRRAAAYNLLQHGITNLCVIGGDGSLTGAN
VFRSEWGSLLEELVKEGKISETTAQTYSHLNIAGLVGSIDNDFCGTDMTIGTDSALHRIM
EVIDAITTTAQXXXXXXXXXXXXXXXXYLALVSALASGADWLFIPEAPPEDGWENFMCER
LGETRSRGSRLNIIIIAEGAIDRNGKPISSSYVKDLVVQRLGFDTRVTVLGHVQRGGTPS
AFDRILSSKMGMEAVMALLEATPDTPACVVSLSGNQSVRLPLMECVQVTKEVQKAMDDKR
FDEAIQLRGRSFENNWNIYKLLAHQKISKEKSSFSLAILNVGAPAAGMNAAVRSAVRTGI
SQGHTVYVVHDGFEGLAKGQXXXXXXXXXXXXXXXXXXXXXXXXTLPRAHLESIVENLRT
YNIHALLVIGGFEAYEGVLQLVEARERYEELCIVMCVIPATISNNVPGTDFSLGSDTAVN
AAMESCDRIKQSASGTKRRVFIVETMGGYCGYLATVTGIAVGADAAYVFEDPFNIHDLKA
NVEHMTEKMKTDIQRGLVLRNEKCHEHYTTEFLYHLYSSEGRGVFDCRTNVLGHLQQGGA
PTPFDRNYGTKLGVKAMLWMSEKLRAVYRKGRVFANAPDSACVIGLRKKAVAFSPVTELK
KDTDFDHRMPREQWWLNLRLMLKMLAHYRISMADYVSGELEHVTRRTLSIDK
Download sequence
Identical sequences ENSDORP00000006568 ENSDORP00000006568

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]