SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000006627 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000006627
Domain Number 1 Region: 137-210
Classification Level Classification E-value
Superfamily AN1-like Zinc finger 6.02e-31
Family AN1-like Zinc finger 0.0000177
Further Details:      
 
Domain Number 2 Region: 15-56
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000000000000185
Family A20-like zinc finger 0.0091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000006627   Gene: ENSDORG00000007071   Transcript: ENSDORT00000007071
Sequence length 215
Comment pep:novel scaffold:dipOrd1:scaffold_11657:3534:8334:1 gene:ENSDORG00000007071 transcript:ENSDORT00000007071 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KEMAQETNQTPGPMLCSTGCGFYGNPRTNGMCSVCYKEHLQRQQNSGRMSPMGTASGSNS
PTSDSASVQRADASLNNCEGAAGSTAEKSRNVPVAALPVTQQMTEMSISREDKITTPKTE
VSEPVVTQPSPSVSQPSTSQSEEKAPELPKPKKNRCFMCRKKVGLTGFDCRCGNLFCGLH
RYSDKHNCPYDYKAEAAAKIRKENPVVVAEKIQRI
Download sequence
Identical sequences ENSDORP00000006627 ENSDORP00000006627

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]