SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000006712 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000006712
Domain Number 1 Region: 123-263
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.02e-27
Family Ankyrin repeat 0.000000123
Further Details:      
 
Domain Number 2 Region: 8-79
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.00000475
Family Ankyrin repeat 0.0000159
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000006712   Gene: ENSDORG00000007157   Transcript: ENSDORT00000007158
Sequence length 1031
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_367:33044:107832:-1 gene:ENSDORG00000007157 transcript:ENSDORT00000007158 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKMADAKQKRNEQLKRWIGSETDLEPPVVKRQKTKVKFDDGAVFLAACSSGDTDEVLKLL
HRGADINYANVDGLTALHQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXFLIGQGAHVGAVNSEGDTPLDIAEEEAMEELLQNEVNRQGVDIEAARKEEERIMLRD
ARQWLNSGHINDIRHAKSGGTALHVAAAKGYTEVLKLLIQAGYDVNIKDYDGWTPLHAAA
HWGKEEACRILVDNLCDMEMVNKVXXXXXXXXXXXXXXXXXXXXXXXXXLHSEKRDKKSP
LIESTANMDNNQSQKTFKNKETLIIEPEKNASRIESLEQEKVDDEEEGKKDESSCSSEED
EEDDSESEAETDKTKPVASVTNANSCSTQAAPVAVTTPTLSSSQGTPTSPIKKFPTSTTT
TKVSPKEEERKDESPASWRLGLRKTGSYGALAEITAAKEAQKEKDTAGVIRSASSPRLSS
SLDNKEKEKDSKGTRLAYVAPTIPRRLASTSDIEEKENRESSSLRTSSSYTRRKWEDDLK
KNSSINEGSTYHKSCSFGRRQDDLISSSVPSTTSTPTVTSAAGLQKSLFSSTSTTTKITT
GSSSAGSQSSTSNRLWAEDSTEKEKDSVPTAVTIPVAPTVVNAAASTTTLTTTTAGTVSS
TSEVRERRRSYLTPVRDEESESQRKARSRQARQSRRSTQGVTLTDLQEAEKTIGRSRSTR
TREQENEEKEKEEKEKQDKEKQEEKKESETSREDEYKQKYSRTYDETYPRYRPVSTSSST
TPSSSLSSLSSSLYASSQLNRPNSLVGITSAYSRGLTKENEREGEKKEEEKEGEDKSQPK
SIRERRRPREKRRSTGVSFWTQDSDENEQEQQSDTEEGSNKKETQVKSLTLYDTSSTSSS
DRYDSLLGRSGSYSYLEDRKPYSSRLKDDSTDFKKXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXERRALERRISEMEEELKMLPDLKADNQRLKDENG
ALIRVISKLSK
Download sequence
Identical sequences ENSDORP00000006712 ENSDORP00000006712

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]