SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000006738 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000006738
Domain Number 1 Region: 268-517
Classification Level Classification E-value
Superfamily Sema domain 8.37e-95
Family Sema domain 0.0000000364
Further Details:      
 
Domain Number 2 Region: 28-231
Classification Level Classification E-value
Superfamily Sema domain 3.66e-60
Family Sema domain 0.0000017
Further Details:      
 
Domain Number 3 Region: 513-564
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000000000192
Family Plexin repeat 0.002
Further Details:      
 
Domain Number 4 Region: 580-661
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000469
Family I set domains 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000006738   Gene: ENSDORG00000007184   Transcript: ENSDORT00000007184
Sequence length 752
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_615:52301:150652:-1 gene:ENSDORG00000007184 transcript:ENSDORT00000007184 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAFQAIFMLVGVLLCSICVKGSSQPQARVYLTFDELRETKTSEHFSLSHHPLDYRILLMD
EDQDRIYVGSKDHIISLNINNISQEPLSVFWPASTIKVDECKMAGKDPTHGCGNFVRVIQ
TFNRTHLYVCGSGAYSPVCTYLNRGRRSEDQVFMIDSKCESGKGRCSFNPNVNTVSVMIN
EELFSGMYIDFMGTDAAIFRSLTKRNAVRTDQHNSKWLSEPMFVDAHVIPXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXNDTGGLRSLVNKWTTFLKARLVCSVTDEDGPET
HFDELEDVFLLETDNPRTTLVYGIFTTSSSVFKGSAVCVYHLSDIQTVFNGPFAHKEGPN
HQLVSYQGRIPYPRPGTCPGGAFTPNMRTTKEFPDDVVTFIRNHPLMYNSIYPIHRRPLI
VRIGTDYKYTKIAVDRVSAADGRYHVLFLGTDRGTVQKVVVLPMNSSASGELILEEMEVF
KAHVPITTMKISSKKQQLYVSSIEGVSQVSLHRCHMYGTACADCCLARDPYCAWDGHSCS
RFYPTGKRRSRRQDVRHGNPLTQCRGFNLKAYRNAAEIVQYGVKNNTTFLECAPKSPQAS
IKWLLQKDKDRRKEVKLNERIIVTSQGLLIRAVQDTDQGLYHCIATENSFKQTIAKINFK
VLDSEMVAVVTDKWSPWTWASSVRALPFHPKDIMGAFSHSEMQMINQYCKDTRQQQQPQG
EELQKMRGDYGKLKALINSRKSRNRRNQLPES
Download sequence
Identical sequences ENSDORP00000006738 ENSDORP00000006738

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]