SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000007091 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000007091
Domain Number 1 Region: 11-134
Classification Level Classification E-value
Superfamily C-type lectin-like 5.6e-25
Family C-type lectin domain 0.0000329
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000007091   Gene: ENSDORG00000007561   Transcript: ENSDORT00000007561
Sequence length 136
Comment pep:novel scaffold:dipOrd1:scaffold_52810:2617:6033:-1 gene:ENSDORG00000007561 transcript:ENSDORT00000007561 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GKYNCPGLPELAAPADHQDSPCSPEWVAHQRKCYLVSTTREPWPSARSSCSKDGAALAVL
DSPKDLTFLQRYAGSAPHWIELKNHAGQKWRGPNGKEVINRFNRTESERCAFLNSTDVGQ
MDCQERLPWICSKDIR
Download sequence
Identical sequences ENSDORP00000007091 ENSDORP00000007091

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]