SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000007099 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000007099
Domain Number 1 Region: 320-599
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 2.03e-75
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.000000472
Further Details:      
 
Domain Number 2 Region: 124-264
Classification Level Classification E-value
Superfamily ThrRS/AlaRS common domain 1.12e-35
Family Threonyl-tRNA synthetase (ThrRS), second 'additional' domain 0.0013
Further Details:      
 
Domain Number 3 Region: 63-124
Classification Level Classification E-value
Superfamily TGS-like 0.00000000000698
Family TGS domain 0.0042
Further Details:      
 
Domain Number 4 Region: 601-631
Classification Level Classification E-value
Superfamily Class II aaRS ABD-related 0.00000294
Family Anticodon-binding domain of Class II aaRS 0.0051
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000007099
Domain Number - Region: 670-710
Classification Level Classification E-value
Superfamily Class II aaRS ABD-related 0.0018
Family Anticodon-binding domain of Class II aaRS 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000007099   Gene: ENSDORG00000007569   Transcript: ENSDORT00000007569
Sequence length 718
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_3525:24940:43194:1 gene:ENSDORG00000007569 transcript:ENSDORT00000007569 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGLYRKWRTFWLRLPRSQACELHTASVPSPPHWLSERFGLFEELWAAQVKRLANMAQNEP
RTIKISLPGGQKVDAVAWNTTPYQLAQQISSTLADTAVAAQVNGEPYDLERPLETDSDLR
FLTFDSPEGKAVFWHSSTHVLGAAAEQFLGAILCRGPSTEYGFYHDFFLGKDRTVQGSEL
SVLEQICREIAAASQPFRRLEVSRDQLQQLFKDNPFKLRLIQEKVAGPTATVYGCGMLVD
LCRGPHLRHTGQIGGLKLLTNSASXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXEQELIFHELSPGSCFFTRGTRVYNALVAFIRAEYARRGFSEVRTPTLFSTK
LWQLSGHWEHYKEDMFTLQPPGTNRAASAQSGHSAGPPVDTLALKPMNCPAHCLMFAHRP
RSWRELPVRLADFGVLHRAEASGSLGGLTRLWRFQQDDAHIFCAPDQLEAEIQGCLDFLR
SVYQVLGFSFRLALSTRPSGFLGEPSLWEQAEQILQRALEEFGEPWDLNPGDGAFYGPKI
DVRLHDALGRPHQCGTIQLDFQLPLRFGLQYKGQAGAPERPVLIHRAVLGSVERLLGVLA
ESCGGRWPLWLSPFQVVVIPVGPEQEVYARQXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXVGQKEQSKRTVNIRTRDNRRLGERDLTEAVQRLLELQNTRVPNAEDLF
Download sequence
Identical sequences ENSDORP00000007099 ENSDORP00000007099

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]